IKMC Project Report - EUCOMM (ID: 116912)

Kank3 MGI:1098615 ENSMUSG00000042099 OTTMUSG00000037208
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation in Progress

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000048560 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MAKFVLNQNLPDLGGPPLYPGPTGSARSPSSPYSVETPYGFHLDLDFLKYVEEIERGPASRRTPGPPHARRPRASRTGLA
GARSPGAWTSSESLASDDGGASGALSPGAFPGLSLPPLSPRSLSRNPRVEHTLLETSRRLEQAQARERALSPARAVTRSP
RGSGRSSPAPNPALASPGPAQLQLVREQMAAALRRLRELEDQARALPELQEQVRALRAEKARLLAGRVQPEQEVEIEARP
DKLAQLRRLTERLATSDRGVRSRASPRAEDPDGLAARRSEGALQVLDPGSRTPDGEPRTRETGTEVVPETREVDAQAVPE
TGEAGVEVVPETVEVDTWVTEELLGLPEAAERELELLRTSLEHQRGVSELLRGRLRELEEAHEAAVTRPQSRDVAAQTTL
GCTEKTTQTELPVENQPRPTAGDEMAPVGILKSIMKKKDGIPGAQSSQGPKSLQFVGVLNGEYESSSSEDGNSDDEDGVA
EHPRSSSSGSDDSSGGSDAGTPGPHNDKDAGDCELETHPELTAGREGRCELNPRLREACIALNQQLNRPRGVTSRDGNAA
RLVAQEWFRVSSQKRSQAESVAGVLRGVKSLGPELLAYVVNLADGNGNTALHYSVSHGNLAISSLLLDT

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000932951 UTR UTR
ENSMUSE00001029577 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001013548 KN_motif (42/42 aa) CDS CDS
ENSMUSE00000303568 CDS CDS
ENSMUSE00000303546 CDS CDS
ENSMUSE00000303524 CDS CDS
ENSMUSE00000303503 Ankyrin_rpt (24/33 aa) CDS CDS + stop codon + UTR
ENSMUSE00000303482 Ankyrin_rpt (10/33 aa) CDS Deleted
ENSMUSE00000303463 Ankyrin_rpt (31/31 aa) | Ankyrin_rpt (33/34 aa) CDS Deleted
ENSMUSE00000303445 Ankyrin_rpt (1/34 aa) CDS Deleted
ENSMUSE00000942556 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000172649 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MAAALRRLRELEDQARALPELQEQVRALRAEKARLLAGRVQPEQEVEIEARPDKLAQLRRLTERLATSDRGVRSRASPRA
EDPDGLAARRSEGALQVLDPGSRTPDGEPRTRETGTEVVPETREVDAQAVPETGEAGVEVVPETVEVDTWVTEELLGLPE
AAERELELLRTSLEHQRGVSELLRGRLRELEEAHEAAVTRPQSRDVAAQTTLGCTEKTTQTELPVENQPRPTAGDEMAPV
GILKSIMKKKDGIPGAQSSQGPKSLQFVGVLNGEYESSSSEDGNSDDEDGVAEHPRSSSSGSDDSSGGSDAGTPGPHNDK
DAGDCELETHPELTAGREGRCELNPRLREACIALNQQLNRPRGVTSRDGNAARLVAQEWFRVSSQKRSQAESVAGVLRGV
KSLGPELLAYVVNLADGNGNTALHYSVSHGNLAISSLLLDT

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000303624 UTR UTR
ENSMUSE00000944287 UTR UTR
ENSMUSE00000976589 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000303568 CDS CDS
ENSMUSE00000303546 CDS CDS
ENSMUSE00000303524 CDS CDS
ENSMUSE00000303503 Ankyrin_rpt (24/33 aa) CDS CDS + stop codon + UTR
ENSMUSE00000303482 Ankyrin_rpt (10/33 aa) CDS Deleted
ENSMUSE00000303463 Ankyrin_rpt (31/31 aa) | Ankyrin_rpt (33/34 aa) CDS Deleted
ENSMUSE00000303445 Ankyrin_rpt (1/34 aa) CDS Deleted
ENSMUSE00000303436 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000173789 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MAKFVLNQNLP

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000303624 UTR UTR
ENSMUSE00001029577 UTR + start codon + CDS
ENSMUSE00000303482 CDS Deleted
ENSMUSE00000303463 Ankyrin_rpt (31/31 aa) | Ankyrin_rpt (33/34 aa) CDS Deleted
ENSMUSE00000303445 Ankyrin_rpt (1/34 aa) CDS Deleted
ENSMUSE00000931678 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000174608 protein_coding No analysis available: incomplete transcript
ENSMUST00000173958 retained_intron No analysis available: incomplete transcript
ENSMUST00000173649 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0865_5_B11 ETPG00282_Y_2_D02 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0865_5_G11 ETPG00282_Y_2_D02 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0865_5_H12 ETPG00282_Y_2_D02 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0865_5_B10 ETPG00282_Y_2_D02 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0865_5_E11 ETPG00282_Y_2_D02 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0865_5_G09 ETPG00282_Y_2_D02 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0865_5_E09 ETPG00282_Y_2_D02 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0865_5_E10 ETPG00282_Y_2_D02 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0865_5_F11 ETPG00282_Y_2_D02 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_A07 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_B02 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_E11 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_F05 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_A02 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_B07 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_E04 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_D01 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_H04 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_A11 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_D07 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_A03 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_D03 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_B09 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_F11 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_D03 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_E08 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_C11 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_B02 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_B01 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_H11 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_D06 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_F01 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_G02 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_H10 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_G04 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_G09 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_D02 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_E02 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Z_2_A04 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
order 447769 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) ETPG00282_Y_2_H04 L1L2_GT1_LF2A_LacZ_BetactP_neo L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors no data available