IKMC Project Report - EUCOMM (ID: 117016)

Calcoco2 MGI:1343177 ENSMUSG00000006056 OTTMUSG00000001956
Pre-pipeline Designs Vectors ES Cells Mice
Design Completed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000068686 protein_coding No protein product (NMD) view

Predicted translation:

MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFKVGWKTTQEYYTFMWAPLPKDQNKDS
ATQQEIQFKGKGRRDGTAQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000790616 UTR UTR
ENSMUSE00000380218 CoCoA (38/240 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000110945 CoCoA (35/240 aa) CDS CDS
ENSMUSE00000110950 CoCoA (45/240 aa) CDS Deleted
ENSMUSE00000110948 CoCoA (35/240 aa) CDS CDS + stop codon + UTR
ENSMUSE00000390101 CoCoA (88/240 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000097162 protein_coding No protein product (NMD) view

Predicted translation:

MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFKVGWKTTQEYYTFMWAPLPKDQNKDS
ATQQEIQFKGKGRRDGTAQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000674120 UTR UTR
ENSMUSE00000380218 CoCoA (38/238 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000110945 CoCoA (35/238 aa) CDS CDS
ENSMUSE00000110950 CoCoA (45/238 aa) CDS Deleted
ENSMUSE00000110948 CoCoA (35/238 aa) CDS CDS + stop codon + UTR
ENSMUSE00000110946 CoCoA (31/238 aa) CDS
ENSMUSE00001090596 CoCoA (55/238 aa) CDS
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available