IKMC Project Report - EUCOMM (ID: 118719)

Panx1 MGI:1860055 ENSMUSG00000031934 OTTMUSG00000035453
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000164273 protein_coding No protein product (NMD) view

Predicted translation: 

MAIAHLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPSSFSWRQAAFV
DSYCWAAVQQKSSLQSESGNLPLWLHKSVGDI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000335413 Innexin (28/204 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000965170 Innexin (47/204 aa) CDS CDS
ENSMUSE00000214793 Innexin (74/204 aa) CDS Deleted
ENSMUSE00001049815 Innexin (57/204 aa) CDS CDS + stop codon + UTR
ENSMUSE00000904743 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000169288 protein_coding No analysis available: incomplete transcript
ENSMUST00000056755 nonsense_mediated_decay Design floxes no exons in transcript ENSMUST00000056755
ENSMUST00000166933 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0927_3_C02 PRPGS00105_C_C06 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 97196 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00105_C_C06 L1L2_Bact_P L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
97196 Knockout First, Reporter-tagged insertion with conditional potential PCS00105_B_C06