IKMC Project Report - EUCOMM (ID: 22651)

Jak2 MGI:96629 ENSMUSG00000024789
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000065796 protein_coding No protein product (NMD) view

Predicted translation: 

MGMACLTMTEMEATSTSPVHQNGDIPGSANSVKQIEPVLQVYLYHSLGQAEGEYLKFPSGEYVAEEICVAASKACGSTSL
IGTVVAAAEPTDTECPVGLKLLCLMTLSCLTFLLSGGMILFTDG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000692343 UTR UTR
ENSMUSE00000474985 UTR UTR
ENSMUSE00000456893 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000145002 CDS Deleted
ENSMUSE00000144996 CDS CDS
ENSMUSE00000145011 CDS CDS + stop codon + UTR
ENSMUSE00000144985 CDS
ENSMUSE00000145018 CDS
ENSMUSE00000144980 SH2 (4/81 aa) CDS
ENSMUSE00000144981 SH2 (38/81 aa) CDS
ENSMUSE00000145008 SH2 (40/81 aa) CDS
ENSMUSE00000144983 Ser-Thr/Tyr_kinase_cat_dom (1/260 aa) CDS
ENSMUSE00000144997 Ser-Thr/Tyr_kinase_cat_dom (45/260 aa) | Prot_kinase_cat_dom (44/255 aa) CDS
ENSMUSE00000258200 Ser-Thr/Tyr_kinase_cat_dom (30/260 aa) | Prot_kinase_cat_dom (30/255 aa) CDS
ENSMUSE00000144990 Ser-Thr/Tyr_kinase_cat_dom (43/260 aa) | Prot_kinase_cat_dom (43/255 aa) CDS
ENSMUSE00000145020 Ser-Thr/Tyr_kinase_cat_dom (47/260 aa) | Prot_kinase_cat_dom (47/255 aa) CDS
ENSMUSE00000145017 Ser-Thr/Tyr_kinase_cat_dom (51/260 aa) | Prot_kinase_cat_dom (51/255 aa) CDS
ENSMUSE00000145015 Ser-Thr/Tyr_kinase_cat_dom (45/260 aa) | Prot_kinase_cat_dom (42/255 aa) CDS
ENSMUSE00000415088 Ser-Thr/Tyr_kinase_cat_dom (8/272 aa) | Prot_kinase_cat_dom (7/270 aa) CDS
ENSMUSE00000145019 Ser-Thr/Tyr_kinase_cat_dom (64/272 aa) | Prot_kinase_cat_dom (64/270 aa) CDS
ENSMUSE00000145001 Ser-Thr/Tyr_kinase_cat_dom (42/272 aa) | Prot_kinase_cat_dom (42/270 aa) CDS
ENSMUSE00000144993 Ser-Thr/Tyr_kinase_cat_dom (58/272 aa) | Prot_kinase_cat_dom (58/270 aa) CDS
ENSMUSE00000145005 Ser-Thr/Tyr_kinase_cat_dom (40/272 aa) | Prot_kinase_cat_dom (40/270 aa) CDS
ENSMUSE00000144988 Ser-Thr/Tyr_kinase_cat_dom (38/272 aa) | Prot_kinase_cat_dom (38/270 aa) CDS
ENSMUSE00000498639 Ser-Thr/Tyr_kinase_cat_dom (24/272 aa) | Prot_kinase_cat_dom (23/270 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000025705 protein_coding No protein product (NMD) view

Predicted translation: 

MGMACLTMTEMEATSTSPVHQNGDIPGSANSVKQIEPVLQVYLYHSLGQAEGEYLKFPSGEYVAEEICVAASKACGSTSL
IGTVVAAAEPTDTECPVGLKLLCLMTLSCLTFLLSGGMILFTDG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000692343 UTR UTR
ENSMUSE00000456893 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000145002 CDS Deleted
ENSMUSE00000144996 CDS CDS
ENSMUSE00000145011 CDS CDS + stop codon + UTR
ENSMUSE00000144985 CDS
ENSMUSE00000145018 CDS
ENSMUSE00000144980 SH2 (4/81 aa) CDS
ENSMUSE00000144981 SH2 (38/81 aa) CDS
ENSMUSE00000145008 SH2 (40/81 aa) CDS
ENSMUSE00000144983 Ser-Thr/Tyr_kinase_cat_dom (1/260 aa) CDS
ENSMUSE00000144997 Ser-Thr/Tyr_kinase_cat_dom (45/260 aa) | Prot_kinase_cat_dom (44/255 aa) CDS
ENSMUSE00000258200 Ser-Thr/Tyr_kinase_cat_dom (30/260 aa) | Prot_kinase_cat_dom (30/255 aa) CDS
ENSMUSE00000144990 Ser-Thr/Tyr_kinase_cat_dom (43/260 aa) | Prot_kinase_cat_dom (43/255 aa) CDS
ENSMUSE00000145020 Ser-Thr/Tyr_kinase_cat_dom (47/260 aa) | Prot_kinase_cat_dom (47/255 aa) CDS
ENSMUSE00000145017 Ser-Thr/Tyr_kinase_cat_dom (51/260 aa) | Prot_kinase_cat_dom (51/255 aa) CDS
ENSMUSE00000145015 Ser-Thr/Tyr_kinase_cat_dom (45/260 aa) | Prot_kinase_cat_dom (42/255 aa) CDS
ENSMUSE00000415088 Ser-Thr/Tyr_kinase_cat_dom (8/272 aa) | Prot_kinase_cat_dom (7/270 aa) CDS
ENSMUSE00000145019 Ser-Thr/Tyr_kinase_cat_dom (64/272 aa) | Prot_kinase_cat_dom (64/270 aa) CDS
ENSMUSE00000145001 Ser-Thr/Tyr_kinase_cat_dom (42/272 aa) | Prot_kinase_cat_dom (42/270 aa) CDS
ENSMUSE00000144993 Ser-Thr/Tyr_kinase_cat_dom (58/272 aa) | Prot_kinase_cat_dom (58/270 aa) CDS
ENSMUSE00000145005 Ser-Thr/Tyr_kinase_cat_dom (40/272 aa) | Prot_kinase_cat_dom (40/270 aa) CDS
ENSMUSE00000144988 Ser-Thr/Tyr_kinase_cat_dom (38/272 aa) | Prot_kinase_cat_dom (38/270 aa) CDS
ENSMUSE00000498639 Ser-Thr/Tyr_kinase_cat_dom (24/272 aa) | Prot_kinase_cat_dom (23/270 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0682_5_G03 PG00206_Y_6_F11 Jak2tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0682_5_D04 PG00206_Y_6_F11 Jak2tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0682_5_G04 PG00206_Y_6_F11 Jak2tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0682_5_F01 PG00206_Y_6_F11 Jak2tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0682_5_B04 PG00206_Y_6_F11 Jak2tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0682_5_A02 PG00206_Y_6_F11 Jak2tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0682_5_E04 PG00206_Y_6_F11 Jak2tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0682_5_F03 PG00206_Y_6_F11 Jak2tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Z_6_H12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_2_B10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_F12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_H07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_A04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04014_Z_6_A12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04014_Z_6_G02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_H02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_E08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_D01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_D10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_2_G12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_H10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_F05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_A05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Z_6_D12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_F03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_G11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_H08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_H09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_C08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_E05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04014_Z_6_D05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_D03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04014_Z_6_D09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_G09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_F06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_C07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_C01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Z_6_B09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_B09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_D04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_C05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_E10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_D12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_A03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_H12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_G04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04014_Z_6_G09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Z_6_E10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 269988 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00206_Y_6_F11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
269988 Knockout-First - Reporter Tagged Insertion PCS00206_A_F10
269988 Knockout-First - Reporter Tagged Insertion PCS04014_A_F03