IKMC Project Report - EUCOMM (ID: 26845)

Abca14 MGI:2388708 ENSMUSG00000062017 OTTMUSG00000022558
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000084640 protein_coding No protein product (NMD) view

Predicted translation:

MDSLQMKQFSVLLWKNFLLKSRNVVGLVVEIILIFLLFVWTLTVRRISKKTSISDVIFNPILLTLPKFLNENFDYELAYV
PSESNAARNITEMVKKDLNFNFKVQGFPSEESFERYIKYENKDAHVLAAIVFDHKFKTSNERLPLQVKYSLRFGRIYDPE
NLFQPSKYQKEIEWNTSTLFPSVPSLGPRNFLENDGGNPGIPAHGGTQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000429415 UTR UTR
ENSMUSE00001001694 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001051599 CDS CDS
ENSMUSE00001012962 CDS CDS
ENSMUSE00000984635 CDS CDS
ENSMUSE00001022452 CDS Deleted
ENSMUSE00001079534 CDS CDS + stop codon + UTR
ENSMUSE00000985028 CDS
ENSMUSE00001091927 CDS
ENSMUSE00000972945 CDS
ENSMUSE00000983272 CDS
ENSMUSE00001025033 ABC_transporter-like (8/121 aa) CDS
ENSMUSE00001015514 ABC_transporter-like (52/121 aa) CDS
ENSMUSE00001076166 ABC_transporter-like (52/121 aa) CDS
ENSMUSE00000980305 ABC_transporter-like (10/121 aa) CDS
ENSMUSE00000527522 CDS
ENSMUSE00000527521 CDS
ENSMUSE00000527520 CDS
ENSMUSE00000527519 CDS
ENSMUSE00000527518 CDS
ENSMUSE00000527517 CDS
ENSMUSE00000527516 CDS
ENSMUSE00000527515 CDS
ENSMUSE00000527514 CDS
ENSMUSE00000527513 CDS
ENSMUSE00001035009 ABC_transporter-like (30/120 aa) CDS
ENSMUSE00000527511 ABC_transporter-like (63/120 aa) CDS
ENSMUSE00001027797 ABC_transporter-like (28/120 aa) CDS
ENSMUSE00000527509 CDS
ENSMUSE00001023264 CDS
ENSMUSE00000527507 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000143257 processed_transcript No analysis available: incomplete transcript
ENSMUST00000130646 retained_intron Target region does not overlap transcript
ENSMUST00000134268 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available