IKMC Project Report - EUCOMM (ID: 26845)
Abca14 MGI:2388708 ENSMUSG00000062017 OTTMUSG00000022558
Mice no data available
Mutagenesis Predictions
This gene has 4 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||
|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000084640 | protein_coding | No protein product (NMD) | view | |||||||
|
Predicted translation: MDSLQMKQFSVLLWKNFLLKSRNVVGLVVEIILIFLLFVWTLTVRRISKKTSISDVIFNPILLTLPKFLNENFDYELAYV PSESNAARNITEMVKKDLNFNFKVQGFPSEESFERYIKYENKDAHVLAAIVFDHKFKTSNERLPLQVKYSLRFGRIYDPE NLFQPSKYQKEIEWNTSTLFPSVPSLGPRNFLENDGGNPGIPAHGGTQ*
|
||||||||||
| ENSMUST00000143257 | processed_transcript | No analysis available: incomplete transcript | ||||||||
| ENSMUST00000130646 | retained_intron | Target region does not overlap transcript | ||||||||
| ENSMUST00000134268 | processed_transcript | No analysis available: incomplete transcript | ||||||||