IKMC Project Report - KOMP-CSD (ID: 29053)

Nfkb1 MGI:97312 ENSMUSG00000028163 OTTMUSG00000016668
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Nfkb1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) EPD0033_4_D01 C57BL/6Dnk or C57BL/6NTac;C57BL/6Brd-Tyrc-Brd;C57BL/6N view
( about ) 		WTSI/UCD
Southern Blot na TV Backbone Assay pass 5' LR-PCR pass
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR pass Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000029812 protein_coding Residual C-terminal product view

Predicted translation: 

MVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSV
VRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENG
GVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFS
DSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHGTINTKFKNGPKDCAKSDD
EESLTLPEKETEGEGPSLPMACTKTEPIALASTMEDKEQDMGFQDNLFLEKALQLARRHANALFDYAVTGDVKMLLAVQR
HLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRVGADLSLLDR
WGNSVLHLAAKEGHDRILSILLKSRKAAPLIDHPNGEGLNAIHIAVMSNSLPCLLLLVAAGAEVNAQEQKSGRTALHLAV
EYDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKAGEDEGVVPGT
TPLDMAANWQVFDILNGKPYEPVFTSDDILPQGDMKQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPA
PSKTLMDNYEVSGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQVHCLPLSSSSTRQHIDELRDSDSVCD
SGVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQEGPIEGKI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000799561 UTR UTR
ENSMUSE00000669322 UTR UTR
ENSMUSE00000973920 UTR + start codon + CDS
ENSMUSE00001092381 CDS Deleted
ENSMUSE00001017156 RHD (8/199 aa) CDS
ENSMUSE00001090875 RHD (33/199 aa) CDS
ENSMUSE00000982232 RHD (50/199 aa) CDS UTR + start codon + CDS
ENSMUSE00000979607 RHD (56/199 aa) CDS CDS
ENSMUSE00001033008 RHD (54/199 aa) CDS CDS
ENSMUSE00000983786 RHD (1/199 aa) CDS CDS
ENSMUSE00000967241 CDS CDS
ENSMUSE00000241961 CDS CDS
ENSMUSE00000176900 CDS CDS
ENSMUSE00001025724 CDS CDS
ENSMUSE00000963294 CDS CDS
ENSMUSE00001056864 CDS CDS
ENSMUSE00000986762 CDS CDS
ENSMUSE00001052095 Ankyrin_rpt (30/30 aa) CDS CDS
ENSMUSE00001045491 CDS CDS
ENSMUSE00000985457 Ankyrin_rpt (24/32 aa) CDS CDS
ENSMUSE00001028291 Ankyrin_rpt (9/32 aa) CDS CDS
ENSMUSE00000977885 CDS CDS
ENSMUSE00001057660 Death (45/73 aa) CDS CDS
ENSMUSE00000993396 Death (28/73 aa) CDS CDS
ENSMUSE00000332259 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000164430 protein_coding Residual C-terminal product view

Predicted translation: 

MVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSV
VRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENG
GVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFS
DSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHGTINTKFKNGPKDCAKSDD
EESLTLPEKETEGEGPSLPMACTKTEPIALASTMEDKEQDMGFQDNLFLEKALQLARRHANALFDYAVTGDVKMLLAVQR
HLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRVGADLSLLDR
WGNSVLHLAAKEGHDRILSILLKSRKAAPLIDHPNGEGLNAIHIAVMSNSLPCLLLLVAAGAEVNAQEQKSGRTALHLAV
EYDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKAGEDEGVVPGT
TPLDMAANWQVFDILNGKPYEPVFTSDDILPQGDMKQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPA
PSKTLMDNYEVSGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQVHCLPLSSSSTRQHIDELRDSDSVCD
SGVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQEGPIEGKI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000911569 UTR + start codon + CDS
ENSMUSE00001092381 CDS Deleted
ENSMUSE00001017156 RHD (8/199 aa) CDS
ENSMUSE00001090875 RHD (33/199 aa) CDS
ENSMUSE00000982232 RHD (50/199 aa) CDS UTR + start codon + CDS
ENSMUSE00000979607 RHD (56/199 aa) CDS CDS
ENSMUSE00001033008 RHD (54/199 aa) CDS CDS
ENSMUSE00000983786 RHD (1/199 aa) CDS CDS
ENSMUSE00000967241 CDS CDS
ENSMUSE00000241961 CDS CDS
ENSMUSE00000176900 CDS CDS
ENSMUSE00001025724 CDS CDS
ENSMUSE00000963294 CDS CDS
ENSMUSE00001056864 CDS CDS
ENSMUSE00000986762 CDS CDS
ENSMUSE00001052095 Ankyrin_rpt (30/30 aa) CDS CDS
ENSMUSE00001045491 CDS CDS
ENSMUSE00000985457 Ankyrin_rpt (24/32 aa) CDS CDS
ENSMUSE00001028291 Ankyrin_rpt (9/32 aa) CDS CDS
ENSMUSE00000977885 CDS CDS
ENSMUSE00001057660 Death (45/73 aa) CDS CDS
ENSMUSE00000993396 Death (28/73 aa) CDS CDS
ENSMUSE00000970676 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000132668 protein_coding Target region does not overlap transcript
ENSMUST00000129428 processed_transcript Target region does not overlap transcript
ENSMUST00000138602 retained_intron No analysis available: incomplete transcript
ENSMUST00000150025 nonsense_mediated_decay Target region does not overlap transcript
ENSMUST00000150007 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0033_4_D01 PGS00023_E_B09 Nfkb1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.F6 view yes view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_4_A01 PGS00023_E_B09 Nfkb1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_4_B02 PGS00023_E_B09 Nfkb1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_4_D02 PGS00023_E_B09 Nfkb1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_4_E01 PGS00023_E_B09 Nfkb1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_4_E02 PGS00023_E_B09 Nfkb1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_4_F01 PGS00023_E_B09 Nfkb1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_4_F02 PGS00023_E_B09 Nfkb1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_4_G01 PGS00023_E_B09 Nfkb1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_4_G02 PGS00023_E_B09 Nfkb1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_4_H01 PGS00023_E_B09 Nfkb1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0033_4_A02 PGS00023_E_B09 Nfkb1tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_4_B01 PGS00023_E_B09 Nfkb1tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_4_C01 PGS00023_E_B09 Nfkb1tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 35825 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PGS00023_A_B09 L1L2_gt0 L3L4_pZero_DTA_kan view
order 35825 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00023_D_4_B09 L1L2_gt0 L3L4_pZero_DTA_kan view
order 35825 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00023_D_1_B09 L1L2_gt0 L3L4_pZero_DTA_kan view
order 35825 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00023_E_2_B09 L1L2_gt0 L3L4_pZero_DTA_kan view
order 35825 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00023_E_3_B09 L1L2_gt0 L3L4_pZero_DTA_kan view
order 35825 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00023_E_1_B09 L1L2_gt0 L3L4_pZero_DTA_kan view
order 35825 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00023_E_4_B09 L1L2_gt0 L3L4_pZero_DTA_kan view
order 35825 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00023_D_2_B09 L1L2_gt0 L3L4_pZero_DTA_kan view
order 35825 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PGS00023_E_B09 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
35825 Knockout-First - Reporter Tagged Insertion PCS00023_E_B09