IKMC Project Report - EUCOMM (ID: 32080)

Ahcy MGI:87968 ENSMUSG00000027597 OTTMUSG00000016006
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000054607 protein_coding No protein product (NMD) view

Predicted translation: 

MSDKLPYKVGAVVQLQHLLYSGPCSGCHCQGWHSSVCLEGRDR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000818282 Adenosylhomocysteinase (3/425 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000326585 Adenosylhomocysteinase (64/425 aa) CDS Deleted
ENSMUSE00000170978 Adenosylhomocysteinase (26/425 aa) CDS CDS
ENSMUSE00000326573 Adenosylhomocysteinase (51/425 aa) CDS CDS + stop codon + UTR
ENSMUSE00000326568 Adenosylhomocysteinase (38/425 aa) CDS
ENSMUSE00000170979 Adenosylhomocysteinase (70/425 aa) | Ado_hCys_hydrolase_NAD-bd (65/162 aa) | D-isomer_2_OHA_DH_NAD-bd (46/91 aa) | IlvN (45/63 aa) CDS
ENSMUSE00000170973 Adenosylhomocysteinase (30/425 aa) | Ado_hCys_hydrolase_NAD-bd (30/162 aa) | D-isomer_2_OHA_DH_NAD-bd (30/91 aa) | IlvN (19/63 aa) CDS
ENSMUSE00000170981 Adenosylhomocysteinase (40/425 aa) | Ado_hCys_hydrolase_NAD-bd (40/162 aa) | D-isomer_2_OHA_DH_NAD-bd (17/91 aa) CDS
ENSMUSE00000360051 Adenosylhomocysteinase (65/425 aa) | Ado_hCys_hydrolase_NAD-bd (29/162 aa) CDS
ENSMUSE00000408826 Adenosylhomocysteinase (43/425 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000137242 protein_coding No analysis available: incomplete transcript
ENSMUST00000146367 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0517_1_H07 PGS00044_A_E03 Ahcytm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0517_1_F08 PGS00044_A_E03 Ahcytm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0517_1_B07 PGS00044_A_E03 Ahcytm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly fail
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0517_1_E07 PGS00044_A_E03 Ahcytm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0517_1_G07 PGS00044_A_E03 Ahcytm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 39491 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PGS00044_A_E03 L1L2_gt1 L3L4_pZero_DTA_kan view
order 39491 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00044_A_8_E03 L1L2_gt1 L3L4_pZero_DTA_kan view
order 39491 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00044_A_6_E03 L1L2_gt1 L3L4_pZero_DTA_kan view
order 39491 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00044_A_5_E03 L1L2_gt1 L3L4_pZero_DTA_kan view
order 39491 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00044_A_7_E03 L1L2_gt1 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
39491 Knockout-First - Reporter Tagged Insertion PCS00044_A_E03