IKMC Project Report - EUCOMM (ID: 33148)

L3mbtl1 MGI:2676663 ENSMUSG00000035576 OTTMUSG00000001061
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000035751 protein_coding No protein product (NMD) view

Predicted translation: 

MEGHTDMEILRTVKGSSTGEVNVHLVARDSAGPHPQLPTTAFIIPTNAATLGLPSTALDVPYPREPVHVGALERVAGSEP
VTATILPQLSTGTGTNSTVRLLDWTGVSAPLPGSGMRFRINEYAPLNMIGVERPRSPEQRHEGGMARRDAGIQHPDVHQD
RQDITSLEPPVDASSCKCQACGPQQSSGLDVGSSGDRCSQPFQKRSVIVENSGCTIASELLKPMKKRKHKEYQSPSEESE
PEAVCPVRRRTAGPGSPTWRSRRPSQPQLASSRTPRQSPITRMASNWA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000803193 UTR UTR
ENSMUSE00000680300 UTR UTR
ENSMUSE00001055945 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001063445 CDS CDS
ENSMUSE00001038858 CDS CDS
ENSMUSE00000979072 CDS CDS
ENSMUSE00000980412 CDS CDS
ENSMUSE00001004699 CDS Deleted
ENSMUSE00000393800 CDS CDS
ENSMUSE00000222757 Mbt (20/73 aa) CDS CDS + stop codon + UTR
ENSMUSE00001039830 Mbt (46/73 aa) CDS
ENSMUSE00000984578 Mbt (8/73 aa) CDS
ENSMUSE00000974766 Mbt (40/71 aa) CDS
ENSMUSE00001069882 Mbt (27/71 aa) CDS
ENSMUSE00001020166 Mbt (6/71 aa) CDS
ENSMUSE00001063991 Mbt (27/70 aa) CDS
ENSMUSE00000551746 Mbt (39/70 aa) CDS
ENSMUSE00000593657 Mbt (5/70 aa) CDS
ENSMUSE00000987574 Znf_C2HC (30/30 aa) CDS
ENSMUSE00000982020 CDS
ENSMUSE00000974414 SAM_type1 (6/65 aa) CDS
ENSMUSE00000353725 SAM_type1 (21/65 aa) CDS
ENSMUSE00000380472 SAM_type1 (38/65 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000156954 protein_coding Target region does not overlap transcript
ENSMUST00000124264 protein_coding No analysis available: incomplete transcript
ENSMUST00000153416 retained_intron No analysis available: incomplete transcript
ENSMUST00000137108 processed_transcript Target region does not overlap transcript
ENSMUST00000125296 processed_transcript No analysis available: incomplete transcript
ENSMUST00000149447 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0039_2_E06 PGS00019_A_B04 L3mbtl1tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen no reads detected LoxP Screen pass 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0039_2_D06 PGS00019_A_B04 L3mbtl1tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen no reads detected LoxP Screen pass 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0036_2_C08 PGS00019_A_B04 L3mbtl1tm2e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen no reads detected LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0036_2_G08 PGS00019_A_B04 L3mbtl1tm2e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen no reads detected LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0039_2_A04 PGS00019_A_B04 L3mbtl1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen no reads detected LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0039_2_C04 PGS00019_A_B04 L3mbtl1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen no reads detected LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0039_2_C06 PGS00019_A_B04 L3mbtl1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 39837 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00019_A_3_B04 L1L2_gt0 L3L4_pZero_kan view
order 39837 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00019_A_4_B04 L1L2_gt0 L3L4_pZero_kan view
order 39837 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PGS00019_A_B04 L1L2_gt0 L3L4_pZero_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
39837 Knockout-First - Reporter Tagged Insertion PCS00019_A_B04