IKMC Project Report - KOMP-CSD (ID: 33501)

Lurap1 MGI:1915325 ENSMUSG00000028701 OTTMUSG00000009308
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000030469 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MEGTAESQTPDLRDVEGKVGRKIPEGLLRGLRGECELGTSGDVLLPGAPSTGHGLGDKIMALRMEL

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000337750 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000745450 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000135982 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0686_1_H09 PG00164_Z_5_B04 Lurap1tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0686_1_C09 PG00164_Z_5_B04 Lurap1tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0686_1_A11 PG00164_Z_5_B04 Lurap1tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0686_1_G10 PG00164_Z_5_B04 Lurap1tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 221346 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00164_Z_1_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221346 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00164_Z_3_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221346 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00164_Z_8_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221346 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00164_Z_2_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221346 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00164_A_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221346 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00164_Z_7_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221346 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00164_Z_6_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221346 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00164_Z_5_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
221346 Knockout First, Reporter-tagged insertion with conditional potential PCS00164_A_B04