IKMC Project Report - KOMP-CSD (ID: 34120)

9430016H08Rik MGI:1915365 ENSMUSG00000025971 OTTMUSG00000029760
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027114 protein_coding No protein product (NMD) view

Predicted translation: 

MALAARLLPLPLLSRPLPGPVTRLRTLGSTEVRLTLTEICCLCRRRLGSSAAPIPRYTRAWTSPALRSWSSRRSLLGRVE
HPPALASLPASPSRSYSTEEQPQQRQRTRMIILGFSNPINWVRTRIYAFLIWAYFDKEFSIAEFSEGAKQEGSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000154567 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000242694 CDS Deleted
ENSMUSE00000242688 CDS Deleted
ENSMUSE00000154565 CDS CDS + stop codon + UTR
ENSMUSE00000392512 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0137_7_E01 PRPGS00072_B_E02 9430016H08Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 49767 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00072_X_1_E02 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49767 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00072_B_E02 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
49767 Knockout First, Reporter-tagged insertion with conditional potential PCS00072_A_E02