IKMC Project Report - EUCOMM (ID: 38360)

1110059E24Rik MGI:1913456 ENSMUSG00000035171 OTTMUSG00000042308
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 9 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000038830 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MSSQKGNVTRSRPQKHQNTFTFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKK

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000973952 DUF2039 (21/91 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001061720 DUF2039 (36/91 aa) CDS CDS + stop codon + UTR
ENSMUSE00001071898 DUF2039 (35/91 aa) CDS Deleted
ENSMUSE00000252581 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000179768 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MSSQKGNVTRSRPQKHQNTFTFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKK

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001022581 DUF2039 (21/91 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001061720 DUF2039 (36/91 aa) CDS CDS + stop codon + UTR
ENSMUSE00001091496 DUF2039 (35/91 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000177577 protein_coding Design floxes no exons in transcript ENSMUST00000177577
ENSMUST00000178523 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MSSQKGNVTRSRPQKHQNTFTFKNDKFDKSVQTK

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001022581 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001014105 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000179553 nonsense_mediated_decay Residual N-terminal, unknown C-terminal view

Predicted translation: 

MSSQKGNVTRSRPQKHQNTFTFKNDKFDKSVQTK

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001067209 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001090209 CDS + stop codon + UTR Deleted
ENSMUSE00000991811 UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000180304 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000178012 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000178781 retained_intron Target region does not overlap transcript
ENSMUST00000177605 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available