IKMC Project Report - EUCOMM (ID: 38701)

Acsl4 MGI:1354713 ENSMUSG00000031278 OTTMUSG00000018811
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Acsl4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) EPD0066_2_D10 C57BL/6Dnk or C57BL/6NTac;C57BL/6Brd-Tyrc-Brd;C57BL/6N view
( about ) 		WTSI/HMGU
Southern Blot na TV Backbone Assay pass 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR pass Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000033634 protein_coding No protein product (NMD) view

Predicted translation: 

MNLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLD
KLFDHAVAKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWINYLEVNCRVNNFGSGLTALGLKPKNTIAIFCETR
AEWMIAAQTCFKYNFPRGLSRYQLC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000475971 UTR UTR
ENSMUSE00000207876 UTR UTR
ENSMUSE00000422236 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000207878 AMP-dep_Synth/Lig (49/475 aa) CDS CDS
ENSMUSE00000207866 AMP-dep_Synth/Lig (37/475 aa) CDS Deleted
ENSMUSE00000207871 AMP-dep_Synth/Lig (47/475 aa) CDS CDS + stop codon + UTR
ENSMUSE00000207864 AMP-dep_Synth/Lig (51/475 aa) CDS
ENSMUSE00000207870 AMP-dep_Synth/Lig (42/475 aa) CDS
ENSMUSE00000207874 AMP-dep_Synth/Lig (24/475 aa) CDS
ENSMUSE00000207879 AMP-dep_Synth/Lig (47/475 aa) CDS
ENSMUSE00000207865 AMP-dep_Synth/Lig (59/475 aa) CDS
ENSMUSE00000207869 AMP-dep_Synth/Lig (26/475 aa) CDS
ENSMUSE00000207873 AMP-dep_Synth/Lig (65/475 aa) CDS
ENSMUSE00000207877 AMP-dep_Synth/Lig (35/475 aa) CDS
ENSMUSE00000207868 CDS
ENSMUSE00000207875 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112903 protein_coding No protein product (NMD) view

Predicted translation: 

MAKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVAKFGKKDSLGTREILSEENEMQPNGKVFKKLILG
NYKWINYLEVNCRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPRGLSRYQLC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000693572 UTR UTR
ENSMUSE00000207876 UTR UTR
ENSMUSE00000693566 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000207878 AMP-dep_Synth/Lig (49/475 aa) CDS CDS
ENSMUSE00000207866 AMP-dep_Synth/Lig (37/475 aa) CDS Deleted
ENSMUSE00000207871 AMP-dep_Synth/Lig (47/475 aa) CDS CDS + stop codon + UTR
ENSMUSE00000207864 AMP-dep_Synth/Lig (51/475 aa) CDS
ENSMUSE00000207870 AMP-dep_Synth/Lig (42/475 aa) CDS
ENSMUSE00000207874 AMP-dep_Synth/Lig (24/475 aa) CDS
ENSMUSE00000207879 AMP-dep_Synth/Lig (47/475 aa) CDS
ENSMUSE00000207865 AMP-dep_Synth/Lig (59/475 aa) CDS
ENSMUSE00000207869 AMP-dep_Synth/Lig (26/475 aa) CDS
ENSMUSE00000207873 AMP-dep_Synth/Lig (65/475 aa) CDS
ENSMUSE00000207877 AMP-dep_Synth/Lig (35/475 aa) CDS
ENSMUSE00000207868 CDS
ENSMUSE00000207875 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112907 protein_coding No protein product (NMD) view

Predicted translation: 

MNLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLD
KLFDHAVAKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWINYLEVNCRVNNFGSGLTALGLKPKNTIAIFCETR
AEWMIAAQTCFKYNFPRGLSRYQLC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000693608 UTR UTR
ENSMUSE00000693607 UTR UTR
ENSMUSE00000422236 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000207878 AMP-dep_Synth/Lig (49/475 aa) CDS CDS
ENSMUSE00000207866 AMP-dep_Synth/Lig (37/475 aa) CDS Deleted
ENSMUSE00000207871 AMP-dep_Synth/Lig (47/475 aa) CDS CDS + stop codon + UTR
ENSMUSE00000207864 AMP-dep_Synth/Lig (51/475 aa) CDS
ENSMUSE00000207870 AMP-dep_Synth/Lig (42/475 aa) CDS
ENSMUSE00000207874 AMP-dep_Synth/Lig (24/475 aa) CDS
ENSMUSE00000207879 AMP-dep_Synth/Lig (47/475 aa) CDS
ENSMUSE00000207865 AMP-dep_Synth/Lig (59/475 aa) CDS
ENSMUSE00000207869 AMP-dep_Synth/Lig (26/475 aa) CDS
ENSMUSE00000207873 AMP-dep_Synth/Lig (65/475 aa) CDS
ENSMUSE00000207877 AMP-dep_Synth/Lig (35/475 aa) CDS
ENSMUSE00000207868 CDS
ENSMUSE00000207875 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112904 protein_coding No protein product (NMD) view

Predicted translation: 

MAKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVAKFGKKDSLGTREILSEENEMQPNGKVFKKLILG
NYKWINYLEVNCRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPRGLSRYQLC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000693572 UTR UTR
ENSMUSE00000207876 UTR UTR
ENSMUSE00000693571 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000207878 AMP-dep_Synth/Lig (49/475 aa) CDS CDS
ENSMUSE00000207866 AMP-dep_Synth/Lig (37/475 aa) CDS Deleted
ENSMUSE00000207871 AMP-dep_Synth/Lig (47/475 aa) CDS CDS + stop codon + UTR
ENSMUSE00000207864 AMP-dep_Synth/Lig (51/475 aa) CDS
ENSMUSE00000207870 AMP-dep_Synth/Lig (42/475 aa) CDS
ENSMUSE00000207874 AMP-dep_Synth/Lig (24/475 aa) CDS
ENSMUSE00000207879 AMP-dep_Synth/Lig (47/475 aa) CDS
ENSMUSE00000207865 AMP-dep_Synth/Lig (59/475 aa) CDS
ENSMUSE00000207869 AMP-dep_Synth/Lig (26/475 aa) CDS
ENSMUSE00000207873 AMP-dep_Synth/Lig (65/475 aa) CDS
ENSMUSE00000207877 AMP-dep_Synth/Lig (35/475 aa) CDS
ENSMUSE00000207868 CDS
ENSMUSE00000207875 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000140520 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0066_2_D10 PGS00033_A_A10 Acsl4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0066_2_F10 PGS00033_A_A10 Acsl4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0066_2_A11 PGS00033_A_A10 Acsl4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0066_2_B11 PGS00033_A_A10 Acsl4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0066_2_B12 PGS00033_A_A10 Acsl4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0066_2_C10 PGS00033_A_A10 Acsl4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0066_2_D11 PGS00033_A_A10 Acsl4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0066_2_E11 PGS00033_A_A10 Acsl4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0066_2_F12 PGS00033_A_A10 Acsl4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0066_2_G10 PGS00033_A_A10 Acsl4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0066_2_G11 PGS00033_A_A10 Acsl4tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 40719 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00033_A_3_A10 L1L2_st1 L3L4_pZero_DTA_kan view
order 40719 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00033_A_A10 L1L2_st1 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
40719 Knockout First, Reporter-tagged insertion with conditional potential PCS00033_A_A10