IKMC Project Report - EUCOMM (ID: 40076)

1700001C02Rik MGI:1922684 ENSMUSG00000029182 OTTMUSG00000022268
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000031078 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAFRSAGTLMTEFNAAFVPPALMPGQSSSSGSITKTRLAFCPVFLTLYFL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000340596 UPF0573/UPF0605 (6/65 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000274100 UPF0573/UPF0605 (60/65 aa) CDS Deleted
ENSMUSE00000186638 CDS CDS + stop codon + UTR
ENSMUSE00000274091 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114743 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAFRSAGTLMTEFNAAFVPPALMPGWYSNNLLCVLCRAVDSPAAAEVLPRQDWHSVPCSLLCTSCEGAGPVPPTHRPASS
E*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000700431 UPF0573/UPF0605 (6/65 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000274100 UPF0573/UPF0605 (60/65 aa) CDS Deleted
ENSMUSE00000700430 CDS + stop codon + UTR CDS
ENSMUSE00000700429 UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000127815 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0144_1_D05 PRPGS00071_A_C07 1700001C02Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0144_1_E06 PRPGS00071_A_C07 1700001C02Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0144_1_C06 PRPGS00071_A_C07 1700001C02Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0144_1_F08 PRPGS00071_A_C07 1700001C02Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0144_1_D06 PRPGS00071_A_C07 1700001C02Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0144_1_C08 PRPGS00071_A_C07 1700001C02Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00071_A_C07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_8_B08 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_5_D07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_1_D07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_1_B08 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_8_C07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_6_B08 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_7_B08 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_5_C07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_6_C07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_7_C07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_1_C07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_5_B08 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_8_D07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 48271 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00071_Z_3_B08 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
48271 Knockout First, Reporter-tagged insertion with conditional potential PCS00071_A_C07