IKMC Project Report - EUCOMM (ID: 41578)

Naa10 MGI:1915255 ENSMUSG00000031388 OTTMUSG00000017704
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 12 wild type transcripts, of which 6 are protein-coding. Following removal of the floxed region, 6 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000033763 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMISEVEPKYYADGEDAYAMKR
DLTQMADELRRHLELKEKGKHMVLAALENKAENKGNVLLSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE
ASDSAS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000733900 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001047217 CDS CDS
ENSMUSE00000980747 GNAT_dom (12/76 aa) CDS CDS
ENSMUSE00000990379 GNAT_dom (16/76 aa) | FR47 (7/64 aa) CDS Deleted
ENSMUSE00001034958 GNAT_dom (39/76 aa) | FR47 (39/64 aa) CDS Deleted
ENSMUSE00000972957 GNAT_dom (11/76 aa) | FR47 (16/64 aa) CDS Deleted
ENSMUSE00000992928 FR47 (4/64 aa) CDS CDS
ENSMUSE00000778660 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114389 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMISEVEPKYYADGEDAYAMKR
DLTQMADEPASGPGSSCLLSGDLGPVSFHPLPSGLLAAAEAAPGAEGKGQAHGSGGLGEQSGEQRQRASELRRGLS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000817369 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001047217 CDS CDS
ENSMUSE00000980747 GNAT_dom (12/76 aa) CDS CDS
ENSMUSE00000990379 GNAT_dom (16/76 aa) | FR47 (7/64 aa) CDS Deleted
ENSMUSE00001034958 GNAT_dom (39/76 aa) | FR47 (39/64 aa) CDS Deleted
ENSMUSE00000972957 GNAT_dom (11/76 aa) | FR47 (16/64 aa) CDS Deleted
ENSMUSE00000992928 FR47 (4/64 aa) CDS CDS
ENSMUSE00000699157 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114390 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMISEVEPKYYADGEDAYAMKR
DLTQMADELRRHLELKEKGKHMVLAALENKAENKGNVLLSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE
ASDSAS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000699159 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001047217 CDS CDS
ENSMUSE00000980747 GNAT_dom (12/74 aa) CDS CDS
ENSMUSE00000990379 GNAT_dom (16/74 aa) CDS Deleted
ENSMUSE00001034958 GNAT_dom (39/74 aa) CDS Deleted
ENSMUSE00000999884 GNAT_dom (9/74 aa) CDS Deleted
ENSMUSE00000992928 CDS CDS
ENSMUSE00000332014 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114391 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMISEVEPKYYADGEDAYAMKR
DLTQMADELRRHLELKEKGKHMVLAALENKAENKGNVLLSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE
ASDSAS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000757979 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001047217 CDS CDS
ENSMUSE00000980747 GNAT_dom (12/66 aa) CDS CDS
ENSMUSE00000990379 GNAT_dom (16/66 aa) CDS Deleted
ENSMUSE00001034958 GNAT_dom (39/66 aa) CDS Deleted
ENSMUSE00000992928 GNAT_dom (1/66 aa) CDS CDS
ENSMUSE00000647175 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000096316 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMISEVEPKYYADGEDAYAMKR
DLTQMADEVRVQPVQGSNSSSRGDSVLGKGGYFRAVRLSEAVVARGKTKIECQPLSL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000699153 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001047217 CDS CDS
ENSMUSE00000980747 GNAT_dom (12/76 aa) CDS CDS
ENSMUSE00000990379 GNAT_dom (16/76 aa) | FR47 (7/64 aa) CDS Deleted
ENSMUSE00001034958 GNAT_dom (39/76 aa) | FR47 (39/64 aa) CDS Deleted
ENSMUSE00000972957 GNAT_dom (11/76 aa) | FR47 (16/64 aa) CDS Deleted
ENSMUSE00000622462 FR47 (4/64 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114387 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMISEVEPKYYADGEDAYAMKR
DLTQMADEPQGLAPLVSCLET*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000699155 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001047217 CDS CDS
ENSMUSE00000980747 GNAT_dom (12/76 aa) CDS CDS
ENSMUSE00000990379 GNAT_dom (16/76 aa) | FR47 (7/64 aa) CDS Deleted
ENSMUSE00001034958 GNAT_dom (39/76 aa) | FR47 (39/64 aa) CDS Deleted
ENSMUSE00000972957 GNAT_dom (11/76 aa) | FR47 (16/64 aa) CDS Deleted
ENSMUSE00000992928 FR47 (4/64 aa) CDS CDS
ENSMUSE00000699154 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000143076 retained_intron No analysis available: incomplete transcript
ENSMUST00000124446 retained_intron No analysis available: incomplete transcript
ENSMUST00000149591 retained_intron Target region does not overlap transcript
ENSMUST00000139105 processed_transcript No analysis available: incomplete transcript
ENSMUST00000141211 processed_transcript No analysis available: incomplete transcript
ENSMUST00000153929 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0074_1_H06 PGS00033_A_C12 Naa10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_C06 PGS00033_A_C12 Naa10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_E06 PGS00033_A_C12 Naa10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR fail 3' SR-PCR fail
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_B06 PGS00033_A_C12 Naa10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_A06 PGS00033_A_C12 Naa10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_E05 PGS00033_A_C12 Naa10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_B04 PGS00033_A_C12 Naa10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_A04 PGS00033_A_C12 Naa10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR pass 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0074_1_D04 PGS00033_A_C12 Naa10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_B05 PGS00033_A_C12 Naa10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_G04 PGS00033_A_C12 Naa10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_H04 PGS00033_A_C12 Naa10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_F04 PGS00033_A_C12 Naa10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_D05 PGS00033_A_C12 Naa10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_G05 PGS00033_A_C12 Naa10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_C04 PGS00033_A_C12 Naa10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0074_1_C05 PGS00033_A_C12 Naa10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 40591 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00033_A_2_B12 L1L2_gt2 L3L4_pZero_DTA_kan view
order 40591 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00033_A_C12 L1L2_gt2 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
40591 Knockout First, Reporter-tagged insertion with conditional potential PCS00033_A_C12