IKMC Project Report - NorCOMM (ID: 42557)

Anxa6 MGI:88255 ENSMUSG00000018340 OTTMUSG00000006325
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Genotype confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000108883 protein_coding No protein product (NMD) view

Predicted translation: 

MAKIAQGAMYRGSVHDFPEFDANQDAEALYTAMKGFGSDKESILELITSRSNKQRQEICQNYKSLYGKDLIEDLKYELTG
KFERLIVNLMRPLAYCDAKEIKDAISPMSETWNLTSLETLPATSRRCWWYCSREPGRMTML*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000662424 UTR UTR
ENSMUSE00000974672 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001018445 Annexin_repeat (13/66 aa) CDS CDS
ENSMUSE00001038700 Annexin_repeat (32/66 aa) CDS CDS
ENSMUSE00001039885 Annexin_repeat (22/66 aa) | Annexin_repeat (9/65 aa) CDS CDS
ENSMUSE00000978404 Annexin_repeat (31/65 aa) CDS Deleted
ENSMUSE00000999450 Annexin_repeat (26/65 aa) CDS CDS
ENSMUSE00001093910 Annexin_repeat (3/66 aa) CDS CDS + stop codon + UTR
ENSMUSE00001075225 Annexin_repeat (32/66 aa) CDS
ENSMUSE00001052354 Annexin_repeat (32/66 aa) CDS
ENSMUSE00001028947 Annexin_repeat (10/66 aa) CDS
ENSMUSE00001058723 Annexin_repeat (41/66 aa) CDS
ENSMUSE00001012315 Annexin_repeat (15/66 aa) CDS
ENSMUSE00001086037 CDS
ENSMUSE00001007359 Annexin_repeat (12/65 aa) CDS
ENSMUSE00001016497 Annexin_repeat (32/65 aa) CDS
ENSMUSE00001069699 Annexin_repeat (22/65 aa) | Annexin_repeat (10/66 aa) CDS
ENSMUSE00001071292 Annexin_repeat (31/66 aa) CDS
ENSMUSE00001018700 Annexin_repeat (26/66 aa) CDS
ENSMUSE00000102741 CDS
ENSMUSE00000992904 Annexin_repeat (3/67 aa) CDS
ENSMUSE00000102755 Annexin_repeat (32/67 aa) CDS
ENSMUSE00000102750 Annexin_repeat (33/67 aa) CDS
ENSMUSE00000102774 Annexin_repeat (1/67 aa) | Annexin_repeat (10/66 aa) CDS
ENSMUSE00000102743 Annexin_repeat (41/66 aa) CDS
ENSMUSE00000662419 Annexin_repeat (15/66 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000102727 protein_coding No protein product (NMD) view

Predicted translation: 

MAKIAQGAMYRGSVHDFPEFDANQDAEALYTAMKGFGSDKESILELITSRSNKQRQEICQNYKSLYGKDLIEDLKYELTG
KFERLIVNLMRPLAYCDAKEIKDAISPMSETWNLTSLETLPATSRRCWWYCSREPGRMTML*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000662424 UTR UTR
ENSMUSE00000974672 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001018445 Annexin_repeat (13/66 aa) CDS CDS
ENSMUSE00001038700 Annexin_repeat (32/66 aa) CDS CDS
ENSMUSE00001039885 Annexin_repeat (22/66 aa) | Annexin_repeat (9/65 aa) CDS CDS
ENSMUSE00000978404 Annexin_repeat (31/65 aa) CDS Deleted
ENSMUSE00000999450 Annexin_repeat (26/65 aa) CDS CDS
ENSMUSE00001093910 Annexin_repeat (3/66 aa) CDS CDS + stop codon + UTR
ENSMUSE00001075225 Annexin_repeat (32/66 aa) CDS
ENSMUSE00001052354 Annexin_repeat (32/66 aa) CDS
ENSMUSE00001028947 Annexin_repeat (10/66 aa) CDS
ENSMUSE00001058723 Annexin_repeat (41/66 aa) CDS
ENSMUSE00001012315 Annexin_repeat (15/66 aa) CDS
ENSMUSE00001086037 CDS
ENSMUSE00001007359 Annexin_repeat (12/65 aa) CDS
ENSMUSE00001016497 Annexin_repeat (32/65 aa) CDS
ENSMUSE00001069699 Annexin_repeat (22/65 aa) | Annexin_repeat (10/66 aa) CDS
ENSMUSE00001071292 Annexin_repeat (31/66 aa) CDS
ENSMUSE00001018700 Annexin_repeat (26/66 aa) CDS
ENSMUSE00000102741 Annexin_repeat (2/66 aa) CDS
ENSMUSE00000102755 Annexin_repeat (32/66 aa) CDS
ENSMUSE00000102750 Annexin_repeat (33/66 aa) CDS
ENSMUSE00000102774 Annexin_repeat (1/66 aa) | Annexin_repeat (10/66 aa) CDS
ENSMUSE00000102743 Annexin_repeat (41/66 aa) CDS
ENSMUSE00000662419 Annexin_repeat (15/66 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000148298 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N00007P0_C_5T_A3 N00007P0_T_1-67.1_M7 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00007P0_C_5T_B3 N00007P0_T_1-67.1_M7 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00007P0_C_5T_C3 N00007P0_T_1-67.1_M7 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00007P0_C_5T_D3 N00007P0_T_1-67.1_M7 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00007P0_C_5T_E3 N00007P0_T_1-67.1_M7 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00007P0_C_5T_F3 N00007P0_T_1-67.1_M7 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00007P0_C_5T_G3 N00007P0_T_1-67.1_M7 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00007P0_C_5T_H3 N00007P0_T_1-67.1_M7 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00007P0_C_2W_F6 N00007P0_T_1-67.1_M7 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 301330 Deletion (Promotorless Cassette) N00007P0_T_1-67.1_M7 L1L2_NTARU-0 L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
301330 Deletion N00007P0_I_1-67.1_M7