IKMC Project Report - NorCOMM (ID: 42563)

Zfp202 MGI:1933401 ENSMUSG00000025602 OTTMUSG00000035370
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Genotype confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000026693 protein_coding No protein product (NMD) view

Predicted translation: 

MATALEPEDQDLWEEEGVLMVKLEDDFTCGPESALEGDDPVLETSHQNFRRFRYQEASSPREALIRLRELCHQWLRPERR
TKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTLVEGLQKQPRRPRRWVTVHVQGQEVLSEETLHLGLEPESSS
EQQDPTQTLTTEQPHEEALRSPDLGTQEQETLQHDEEHLPLPECEVPVSQDVDLPTEQGSGHPEMVALLTALSQHFQFPD
*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000897592 UTR UTR
ENSMUSE00000152024 Tscrpt_reg_SCAN (92/93 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000998008 Tscrpt_reg_SCAN (1/93 aa) CDS CDS
ENSMUSE00000991596 CDS CDS
ENSMUSE00001092968 Krueppel-associated_box (39/39 aa) CDS Deleted
ENSMUSE00001087568 CDS CDS + stop codon + UTR
ENSMUSE00000379619 Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (22/22 aa) | Znf_C2H2 (23/23 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000168832 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MATALEPEDQDLWEEEGVLMVKLEDDFTCGPESALEGDDPVLETSHQNFRRFRYQEASSPREALIRLRELCHQWLRPERR
TKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTLVEGLQKQPRRPRRWVTVHVQGQEVLSEETLHLGLEPESSS
EQQDPTQTLTTEQPHEEALRSPDLGTQEQETLQHDEEHLPLPECEVPVSQDVDLPTEQGSGHPEMVALLTALSQET*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000152021 UTR UTR
ENSMUSE00000152024 Tscrpt_reg_SCAN (92/93 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000998008 Tscrpt_reg_SCAN (1/93 aa) CDS CDS
ENSMUSE00000991596 CDS CDS
ENSMUSE00001092968 Krueppel-associated_box (39/39 aa) CDS Deleted
ENSMUSE00000379619 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000168691 nonsense_mediated_decay No protein product (NMD) view

Predicted translation: 

MATALEPEDQDLWEEEGVLMVKLEDDFTCGPESALEGDDPVLETSHQNFRRFRYQEASSPREALIRLRELCHQWLRPERR
TKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTLVEGLQKQPRRPRR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000901081 UTR UTR
ENSMUSE00000902040 Tscrpt_reg_SCAN (90/90 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000966640 Tscrpt_reg_SCAN (1/90 aa) CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00000964754 UTR UTR
ENSMUSE00000988567 UTR Deleted
ENSMUSE00001085184 UTR UTR
ENSMUSE00000912386 UTR UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N00005P0_C_11T_B2 N00005P0_T_1-67.1_M5 Deletion (Promotorless Cassette) C2 unavailable no no data reported    ( about )
order N00005P0_C_11T_C1 N00005P0_T_1-67.1_M5 Deletion (Promotorless Cassette) C2 unavailable no no data reported    ( about )
order N00005P0_C_11T_D2 N00005P0_T_1-67.1_M5 Deletion (Promotorless Cassette) C2 unavailable no no data reported    ( about )
order N00005P0_C_11T_E2 N00005P0_T_1-67.1_M5 Deletion (Promotorless Cassette) C2 unavailable no no data reported    ( about )
order N00005P0_C_11T_F1 N00005P0_T_1-67.1_M5 Deletion (Promotorless Cassette) C2 unavailable no no data reported    ( about )
order N00005P0_C_11T_G1 N00005P0_T_1-67.1_M5 Deletion (Promotorless Cassette) C2 unavailable no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order - Deletion (Promotorless Cassette) N00005P0_T_1-67.1_M5 L1L2_NTARU-0 L3L4_pZero_DTA_kan unavailable

Intermediate Vectors

Design ID Vector Type Intermediate Vector
- Deletion N00005P0_I_1-67.1_M5