IKMC Project Report - NorCOMM (ID: 42611)

Amotl2 MGI:1929286 ENSMUSG00000032531 OTTMUSG00000033309
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 13 wild type transcripts, of which 8 are protein-coding. Following removal of the floxed region, 8 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000035121 protein_coding No protein product (NMD) view

Predicted translation: 

MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGAGGTGSPQASLEIGAPEDSQVLQQATRQEPQGQEHQ
GGETHLAENRLYRLCPQPSKGEELPTYEEAKAHSQYYAAQQAGSRPHVGDRDPRGGVSGGGRRQDEALRELRHGHVRSLS
ERLLQLSLERNGARVPSHMSSSHSFPQLARSQQGPQPRGPPAEGPEPRGPPPQYPHAVMAQETAAVTDPRYRPRSSPHFQ
HAEVSWKMKSSGSLRPTRA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000693344 UTR UTR
ENSMUSE00001046267 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000983397 CDS Deleted
ENSMUSE00001005252 CDS CDS + stop codon + UTR
ENSMUSE00001087621 CDS
ENSMUSE00000987816 Angiomotin_C (43/210 aa) CDS
ENSMUSE00001009471 Angiomotin_C (104/210 aa) CDS
ENSMUSE00000976585 Angiomotin_C (64/210 aa) CDS
ENSMUSE00001007195 CDS
ENSMUSE00001080436 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000153965 protein_coding No protein product (NMD) view

Predicted translation: 

MSGVREELDRMPSALRPGACWPLSRQVCASQRSMRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGAGG
TGSPQASLEIGAPEDSQVLQQATRQEPQGQEHQGGETHLAENRLYRLCPQPSKGEELPTYEEAKAHSQYYAAQQAGSRPH
VGDRDPRGGVSGGGRRQDEALRELRHGHVRSLSERLLQLSLERNGARVPSHMSSSHSFPQLARSQQGPQPRGPPAEGPEP
RGPPPQYPHAVMAQETAAVTDPRYRPRSSPHFQHAEVSWKMKSSGSLRPTRA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001043194 UTR UTR
ENSMUSE00000842158 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001034368 CDS CDS
ENSMUSE00000983397 CDS Deleted
ENSMUSE00001005252 CDS CDS + stop codon + UTR
ENSMUSE00001087621 CDS
ENSMUSE00000987816 Angiomotin_C (43/210 aa) CDS
ENSMUSE00001009471 Angiomotin_C (104/210 aa) CDS
ENSMUSE00000976585 Angiomotin_C (64/210 aa) CDS
ENSMUSE00001007195 CDS
ENSMUSE00000737477 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000130602 protein_coding No protein product (NMD) view

Predicted translation: 

MAQETAAVTDPRYRPRSSPHFQHAEVSWKMKSSGSLRPTRA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000768911 UTR UTR
ENSMUSE00000732150 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000983397 CDS Deleted
ENSMUSE00001005252 CDS CDS + stop codon + UTR
ENSMUSE00001087621 CDS
ENSMUSE00000987816 Angiomotin_C (43/210 aa) CDS
ENSMUSE00001009471 Angiomotin_C (104/210 aa) CDS
ENSMUSE00000976585 Angiomotin_C (64/210 aa) CDS
ENSMUSE00001007195 CDS
ENSMUSE00001080436 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000153911 protein_coding Target region does not overlap transcript
ENSMUST00000145913 protein_coding Target region does not overlap transcript
ENSMUST00000145937 protein_coding Target region does not overlap transcript
ENSMUST00000156485 protein_coding Target region does not overlap transcript
ENSMUST00000134483 protein_coding Target region does not overlap transcript
ENSMUST00000142011 nonsense_mediated_decay No protein product (NMD) view

Predicted translation: 

MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGAGGTGSPQASLEIGAPEDSQVLQQATRQEPQGQEHQ
GGETHLAENRLYRLCPQPSKGEELPTYEEAKAHSQYYAAQQAGSRPHVGDRDPRGGVSGGGRRQDEALRELRHGHVRSLS
ERLLQLSLERNGARVPSHMSSSHSFPQLARSQQGPQPRGPPAEGPEPRGPPPQYPHAVMAQETAAVTDPRYRPRSSPHFQ
HAEVSWKMKSSGSLRPTRA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000693344 UTR UTR
ENSMUSE00001046267 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000983397 CDS Deleted
ENSMUSE00001005252 CDS CDS + stop codon + UTR
ENSMUSE00001087621 CDS
ENSMUSE00000987816 Angiomotin_C (43/210 aa) CDS
ENSMUSE00001009471 Angiomotin_C (104/210 aa) CDS
ENSMUSE00000976585 Angiomotin_C (64/210 aa) CDS
ENSMUSE00000728122 CDS + stop codon + UTR
ENSMUSE00000998147 UTR UTR
ENSMUSE00001023949 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000138224 retained_intron No analysis available: incomplete transcript
ENSMUST00000136934 retained_intron Target region does not overlap transcript
ENSMUST00000155143 processed_transcript No analysis available: incomplete transcript
ENSMUST00000126616 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N00015P0_C_15W_B10 N00015P0_T_1-67.1_M15 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00015P0_C_15W_B11 N00015P0_T_1-67.1_M15 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00015P0_C_15W_C11 N00015P0_T_1-67.1_M15 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00015P0_C_15W_D9 N00015P0_T_1-67.1_M15 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00015P0_C_15W_E10 N00015P0_T_1-67.1_M15 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00015P0_C_15W_F10 N00015P0_T_1-67.1_M15 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00015P0_C_15W_F9 N00015P0_T_1-67.1_M15 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00015P0_C_15W_G10 N00015P0_T_1-67.1_M15 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 301349 Deletion (Promotorless Cassette) N00015P0_T_1-67.1_M15 L1L2_NTARU-2 L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
301349 Deletion N00015P0_I_1-67.1_M15