IKMC Project Report - NorCOMM (ID: 42707)

Ahcy MGI:87968 ENSMUSG00000027597 OTTMUSG00000016006
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000054607 protein_coding No protein product (NMD) view

Predicted translation: 

MSDKLPYKVGAVVQLQHLLYSGPCSGCHCQGWHSSVCLEGRDR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000818282 Adenosylhomocysteinase (3/425 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000326585 Adenosylhomocysteinase (64/425 aa) CDS Deleted
ENSMUSE00000170978 Adenosylhomocysteinase (26/425 aa) CDS CDS
ENSMUSE00000326573 Adenosylhomocysteinase (51/425 aa) CDS CDS + stop codon + UTR
ENSMUSE00000326568 Adenosylhomocysteinase (38/425 aa) CDS
ENSMUSE00000170979 Adenosylhomocysteinase (70/425 aa) | Ado_hCys_hydrolase_NAD-bd (65/162 aa) | D-isomer_2_OHA_DH_NAD-bd (46/91 aa) | IlvN (45/63 aa) CDS
ENSMUSE00000170973 Adenosylhomocysteinase (30/425 aa) | Ado_hCys_hydrolase_NAD-bd (30/162 aa) | D-isomer_2_OHA_DH_NAD-bd (30/91 aa) | IlvN (19/63 aa) CDS
ENSMUSE00000170981 Adenosylhomocysteinase (40/425 aa) | Ado_hCys_hydrolase_NAD-bd (40/162 aa) | D-isomer_2_OHA_DH_NAD-bd (17/91 aa) CDS
ENSMUSE00000360051 Adenosylhomocysteinase (65/425 aa) | Ado_hCys_hydrolase_NAD-bd (29/162 aa) CDS
ENSMUSE00000408826 Adenosylhomocysteinase (43/425 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000137242 protein_coding No analysis available: incomplete transcript
ENSMUST00000146367 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N00009P0_C_6T_C10 N00009P0_T_1-67.1_M9 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00009P0_C_6T_C11 N00009P0_T_1-67.1_M9 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00009P0_C_6T_C9 N00009P0_T_1-67.1_M9 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00009P0_C_6T_D10 N00009P0_T_1-67.1_M9 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00009P0_C_6T_D11 N00009P0_T_1-67.1_M9 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00009P0_C_6T_F11 N00009P0_T_1-67.1_M9 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00009P0_C_6T_G11 N00009P0_T_1-67.1_M9 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
order N00009P0_C_6T_H11 N00009P0_T_1-67.1_M9 Deletion (Promotorless Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 301350 Deletion (Promotorless Cassette) N00009P0_T_1-67.1_M9 L1L2_NTARU-1 L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
301350 Deletion N00009P0_I_1-67.1_M9