IKMC Project Report - NorCOMM (ID: 45982)

Cyp2u1 MGI:1918769 ENSMUSG00000027983
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000106337 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MSSLGDQRPAAGEQPGARLHVRATGGALLLCLLAVLLGWVWLRRQRACGIPPGPKPRPLVGNFGHLLVPRFLRPQFWLGS
GSQTDTVGQHVYLARMARVYGNIFSFFIGHRLVVVLSDFHSVREALVQQAEVFSDRPRMPLISIMTKEKGKRVCMGEQLA
KMELFLMFVSLMQTFTFALPEGSEKPVMTGRFGLTLAPHPFNVTISKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000669529 Cyt_P450 (81/458 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000669525 Cyt_P450 (213/458 aa) CDS Deleted
ENSMUSE00001092890 Cyt_P450 (55/458 aa) CDS Deleted
ENSMUSE00001063383 Cyt_P450 (57/458 aa) CDS Deleted
ENSMUSE00000980463 Cyt_P450 (56/458 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01917P1_C_181W_B7 N01917P1_T_186.1_A07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01917P1_C_181W_E8 N01917P1_T_186.1_A07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01917P1_C_181W_G8 N01917P1_T_186.1_A07 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 238748 Deletion (Promotor Driven Cassette) N01917P1_T_186.1_A07 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
238748 Deletion N01917P1_I_186.1_A07