IKMC Project Report - KOMP-CSD (ID: 50027)

Maf1 MGI:1916127 ENSMUSG00000022553 OTTMUSG00000034711
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 14 wild type transcripts, of which 6 are protein-coding. Following removal of the floxed region, 6 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000161527 protein_coding No protein product view

Predicted translation: 

MSRLQPVWAGRAWSNGTSPRSFFPRIQCGPSGGRGAALQS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000849913 UTR UTR
ENSMUSE00000848497 UTR UTR
ENSMUSE00001020931 Maf1 (4/179 aa) UTR + start codon + CDS Deleted
ENSMUSE00000128264 Maf1 (44/179 aa) CDS Deleted
ENSMUSE00000128266 Maf1 (56/179 aa) CDS Deleted
ENSMUSE00000128261 Maf1 (41/179 aa) CDS Deleted
ENSMUSE00001064702 Maf1 (37/179 aa) CDS Deleted
ENSMUSE00001060595 CDS Deleted
ENSMUSE00000392168 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000023212 protein_coding No protein product view

Predicted translation: 

MSRLQPVWAGRAWSNGTSPRSFFPRIQCGPSGGRGAALQS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000861353 UTR UTR
ENSMUSE00001020931 Maf1 (4/179 aa) UTR + start codon + CDS Deleted
ENSMUSE00000128264 Maf1 (44/179 aa) CDS Deleted
ENSMUSE00000128266 Maf1 (56/179 aa) CDS Deleted
ENSMUSE00000128261 Maf1 (41/179 aa) CDS Deleted
ENSMUSE00001064702 Maf1 (37/179 aa) CDS Deleted
ENSMUSE00001060595 CDS Deleted
ENSMUSE00000851952 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000160853 protein_coding No protein product view

Predicted translation: 

MSRLQPVWAGRAWSNGTSPRSFFPRIQCGPSGGRGAALQS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000849913 UTR UTR
ENSMUSE00001064029 Maf1 (4/179 aa) UTR + start codon + CDS Deleted
ENSMUSE00000128264 Maf1 (44/179 aa) CDS Deleted
ENSMUSE00000128266 Maf1 (56/179 aa) CDS Deleted
ENSMUSE00000128261 Maf1 (41/179 aa) CDS Deleted
ENSMUSE00001064702 Maf1 (37/179 aa) CDS Deleted
ENSMUSE00001060595 CDS Deleted
ENSMUSE00000851952 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000160172 protein_coding No protein product view

Predicted translation: 

MSRLQPVWAGRAWSNGTSPRSFFPRIQCGPSGGRGAALQS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000848261 UTR UTR
ENSMUSE00001020931 Maf1 (4/179 aa) UTR + start codon + CDS Deleted
ENSMUSE00000128264 Maf1 (44/179 aa) CDS Deleted
ENSMUSE00000128266 Maf1 (56/179 aa) CDS Deleted
ENSMUSE00000128261 Maf1 (41/179 aa) CDS Deleted
ENSMUSE00001064702 Maf1 (37/179 aa) CDS Deleted
ENSMUSE00000858098 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000160914 protein_coding No analysis available: incomplete transcript
ENSMUST00000161072 protein_coding No analysis available: incomplete transcript
ENSMUST00000162865 retained_intron No analysis available: incomplete transcript
ENSMUST00000162871 retained_intron No analysis available: incomplete transcript
ENSMUST00000160069 retained_intron No analysis available: incomplete transcript
ENSMUST00000161391 retained_intron No analysis available: incomplete transcript
ENSMUST00000161786 retained_intron No analysis available: incomplete transcript
ENSMUST00000160875 retained_intron No analysis available: incomplete transcript
ENSMUST00000160097 retained_intron Target region does not overlap transcript
ENSMUST00000160857 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0246_8_G11 PRPGS00100_C_F06 Maf1tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A1.N3 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) fail Vector Integrity pass
Distribution Centre
Karyotype 0.6 - 0.51 Copy Number pass Cells Thawed Correctly -
5' LR-PCR fail 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 95120 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00100_W_4_F06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 95120 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00100_W_2_F06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 95120 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00100_W_3_F06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 95120 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00100_C_F06 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
95120 Knockout First, Reporter-tagged insertion with conditional potential PCS00100_A_F06
95120 Knockout First, Reporter-tagged insertion with conditional potential PCS00100_D_F06