IKMC Project Report - NorCOMM (ID: 65720)

Abca1 MGI:99607 ENSMUSG00000015243 OTTMUSG00000007157
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000030010 protein_coding No protein product (NMD) view

Predicted translation: 

MACWPQLRLLLWKNLTFRRRQTRVSPVLRRSEASSVQPKRYQH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000458891 UTR UTR
ENSMUSE00000366299 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000226982 CDS Deleted
ENSMUSE00000226974 CDS Deleted
ENSMUSE00000409749 CDS CDS + stop codon + UTR
ENSMUSE00000226956 CDS
ENSMUSE00000178118 CDS
ENSMUSE00000226945 CDS
ENSMUSE00000385970 CDS
ENSMUSE00000226930 CDS
ENSMUSE00000226921 CDS
ENSMUSE00000226906 CDS
ENSMUSE00000178083 CDS
ENSMUSE00000178134 CDS
ENSMUSE00000339683 CDS
ENSMUSE00000337239 CDS
ENSMUSE00000386705 CDS
ENSMUSE00000178076 CDS
ENSMUSE00000352915 ABC_transporter-like (3/122 aa) CDS
ENSMUSE00000178129 ABC_transporter-like (45/122 aa) CDS
ENSMUSE00000178121 ABC_transporter-like (49/122 aa) CDS
ENSMUSE00000527248 ABC_transporter-like (28/122 aa) CDS
ENSMUSE00000178082 CDS
ENSMUSE00000178072 CDS
ENSMUSE00000398254 CDS
ENSMUSE00000178073 CDS
ENSMUSE00000178102 CDS
ENSMUSE00000407456 CDS
ENSMUSE00000178151 CDS
ENSMUSE00000178142 CDS
ENSMUSE00000378313 CDS
ENSMUSE00000413907 CDS
ENSMUSE00000178155 CDS
ENSMUSE00000412173 CDS
ENSMUSE00000226741 CDS
ENSMUSE00000370795 CDS
ENSMUSE00000527246 CDS
ENSMUSE00000226714 CDS
ENSMUSE00000226705 CDS
ENSMUSE00000226697 CDS
ENSMUSE00000178158 CDS
ENSMUSE00000178085 CDS
ENSMUSE00000178140 CDS
ENSMUSE00000178111 ABC_transporter-like (23/121 aa) CDS
ENSMUSE00001045186 ABC_transporter-like (48/121 aa) CDS
ENSMUSE00001063647 ABC_transporter-like (45/121 aa) CDS
ENSMUSE00001087064 ABC_transporter-like (6/121 aa) CDS
ENSMUSE00000996101 CDS
ENSMUSE00000380728 CDS
ENSMUSE00000374388 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000149127 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones (Conditional Ready)

Note: These mutations can be made conditional by a "docking" procedure which uses the attP/puro docking site in the cassette.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order N01316P1_C_135W_A3 N01316P1_T_172.5_A08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01316P1_C_135W_A5 N01316P1_T_172.5_A08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01316P1_C_135W_D6 N01316P1_T_172.5_A08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
order N01316P1_C_135W_E6 N01316P1_T_172.5_A08 Deletion (Promotor Driven Cassette) C2 view no no data reported    ( about )
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 232850 Deletion (Promotor Driven Cassette) N01316P1_T_172.5_A08 L1L2_GOHANU L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
232850 Deletion N01316P1_I_172.5_A08