IKMC Project Report - EUCOMM (ID: 72416)

Brd7 MGI:1349766 ENSMUSG00000031660 OTTMUSG00000017292
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Brd7tm2a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) EPD0001_3_E04 129S5/SvEvBrd/Wtsi;129S5/SvEvBrd/Wtsi;129S7 view
( about ) 		WTSI/Harwell
Southern Blot na TV Backbone Assay na 5' LR-PCR na
Loss of WT Allele (LOA) qPCR na Homozygous Loss of WT Allele (LOA) SR-PCR pass Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000034085 protein_coding No protein product (NMD) view

Predicted translation: 

MGKKHKKHKSDRHFYEEYVEKPLKLVLKVGGSEVTELSTGSSGHDSSLFEDRSDHDKHKDRKRKKRKKGEKQAPGEEKGR
KRRRVKEDKKKRDRDRAENEVDRDLQCHVPIRLDLPPEKPLTSSLAKQEEVEQTPLQEALNQLMRQLQRITSS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000372072 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001065137 CDS CDS
ENSMUSE00001071729 CDS CDS
ENSMUSE00000244183 Bromodomain (8/83 aa) CDS CDS
ENSMUSE00000335972 Bromodomain (49/83 aa) CDS Deleted
ENSMUSE00000376477 Bromodomain (27/83 aa) CDS CDS + stop codon + UTR
ENSMUSE00000244163 DUF3512 (9/247 aa) CDS
ENSMUSE00000244154 DUF3512 (42/247 aa) CDS
ENSMUSE00000211569 DUF3512 (26/247 aa) CDS
ENSMUSE00000211568 DUF3512 (37/247 aa) CDS
ENSMUSE00000211563 DUF3512 (46/247 aa) CDS
ENSMUSE00000994918 DUF3512 (38/247 aa) CDS
ENSMUSE00001049095 DUF3512 (19/247 aa) CDS
ENSMUSE00000973107 DUF3512 (34/247 aa) CDS
ENSMUSE00000978941 CDS
ENSMUSE00000211561 CDS
ENSMUSE00000763930 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000139675 retained_intron Target region does not overlap transcript
ENSMUST00000149841 processed_transcript Target region does not overlap transcript
ENSMUST00000145609 processed_transcript Target region does not overlap transcript
ENSMUST00000135471 processed_transcript Target region does not overlap transcript
ENSMUST00000131748 processed_transcript Target region does not overlap transcript
ENSMUST00000146370 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0001_3_E04 PGS00001_A_C12 Brd7tm2a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) SI2.3 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 39614 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PGS00001_A_C12 L1L2_gt2 L3L4_pZero_DTA_kan view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
39614 Knockout-First - Reporter Tagged Insertion PCS00001_A_C12