IKMC Project Report - EUCOMM (ID: 78838)

G3bp2 MGI:2442040 ENSMUSG00000029405
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed G3bp2tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) EPD0598_4_D01 C57BL/6NTac;C57BL/6NTac;C57BL/6N-Atm1Brd/a view
( about ) 		WTSI/CNB
Southern Blot na TV Backbone Assay pass 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000169094 protein_coding No protein product (NMD) view

Predicted translation: 

MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQNSQKMKWKRSKKTGSRLLNLCK
RMLTALTMTHTP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000885486 UTR UTR
ENSMUSE00000188561 NTF2 (21/123 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000188551 NTF2 (28/123 aa) CDS CDS
ENSMUSE00000188547 NTF2 (58/123 aa) CDS Deleted
ENSMUSE00000323144 NTF2 (17/123 aa) CDS Deleted
ENSMUSE00000188545 CDS CDS + stop codon + UTR
ENSMUSE00000188556 CDS
ENSMUSE00000188546 CDS
ENSMUSE00000188558 CDS
ENSMUSE00000323118 RRM_dom (20/58 aa) CDS
ENSMUSE00000323110 RRM_dom (39/58 aa) CDS
ENSMUSE00000901438 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000164378 protein_coding No protein product (NMD) view

Predicted translation: 

MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQNSQKMKWKRSKKTGSRLLNLCK
RMLTALTMTHTP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000908271 UTR UTR
ENSMUSE00000188561 NTF2 (21/123 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000188551 NTF2 (28/123 aa) CDS CDS
ENSMUSE00000188547 NTF2 (58/123 aa) CDS Deleted
ENSMUSE00000323144 NTF2 (17/123 aa) CDS Deleted
ENSMUSE00000188545 CDS CDS + stop codon + UTR
ENSMUSE00000188556 CDS
ENSMUSE00000188546 CDS
ENSMUSE00000188558 CDS
ENSMUSE00000323118 RRM_dom (20/58 aa) CDS
ENSMUSE00000323110 RRM_dom (39/58 aa) CDS
ENSMUSE00000901438 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000167918 protein_coding No protein product (NMD) view

Predicted translation: 

MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQNSQKMKWKRSKKTGSRLLNLCK
RMLTALTMTHTP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000885486 UTR UTR
ENSMUSE00000188561 NTF2 (21/123 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000188551 NTF2 (28/123 aa) CDS CDS
ENSMUSE00000188547 NTF2 (58/123 aa) CDS Deleted
ENSMUSE00000323144 NTF2 (17/123 aa) CDS Deleted
ENSMUSE00000188545 CDS CDS + stop codon + UTR
ENSMUSE00000188556 CDS
ENSMUSE00000188558 CDS
ENSMUSE00000323118 RRM_dom (20/58 aa) CDS
ENSMUSE00000323110 RRM_dom (39/58 aa) CDS
ENSMUSE00000901438 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000113127 protein_coding No protein product (NMD) view

Predicted translation: 

MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQNSQKMKWKRSKKTGSRLLNLCK
RMLTALTMTHTP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000513954 UTR UTR
ENSMUSE00000188561 NTF2 (21/123 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000188551 NTF2 (28/123 aa) CDS CDS
ENSMUSE00000188547 NTF2 (58/123 aa) CDS Deleted
ENSMUSE00000323144 NTF2 (17/123 aa) CDS Deleted
ENSMUSE00000188545 CDS CDS + stop codon + UTR
ENSMUSE00000188556 CDS
ENSMUSE00000188558 CDS
ENSMUSE00000323118 RRM_dom (20/58 aa) CDS
ENSMUSE00000323110 RRM_dom (39/58 aa) CDS
ENSMUSE00000914466 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0598_4_D01 PG00204_Z_1_H01 G3bp2tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view yes view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0598_4_A03 PG00204_Z_1_H01 G3bp2tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0598_4_D04 PG00204_Z_1_H01 G3bp2tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0598_4_F03 PG00204_Z_1_H01 G3bp2tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0598_4_F04 PG00204_Z_1_H01 G3bp2tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0598_4_H01 PG00204_Z_1_H01 G3bp2tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0598_4_H02 PG00204_Z_1_H01 G3bp2tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0598_4_A01 PG00204_Z_1_H01 G3bp2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0598_4_B01 PG00204_Z_1_H01 G3bp2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0598_4_C02 PG00204_Z_1_H01 G3bp2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0598_4_C03 PG00204_Z_1_H01 G3bp2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0598_4_G01 PG00204_Z_1_H01 G3bp2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0598_4_H04 PG00204_Z_1_H01 G3bp2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_E12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_G08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_H11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_H01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_G07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_C12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_D09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_E05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_B06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_D06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_D03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_H02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 243584 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00204_Z_1_D12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
243584 Knockout-First - Reporter Tagged Insertion PCS00204_A_A12