IKMC Project Report - EUCOMM (ID: 78978)

F11 MGI:99481 ENSMUSG00000031645
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000034064 protein_coding No protein product (NMD) view

Predicted translation:

MTSLHQVLYFIFFASVSSECVTKVFKDISFQGGDLSTVFTPSATYCRLVCTHHPRCLLFTFMAESSSDDPTKWFACILKD
SVTEILPMVNMTGAISGYSFKQCPQQLSIKCVF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000281998 UTR UTR
ENSMUSE00000281991 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000281983 PAN-1_domain (51/78 aa) CDS CDS
ENSMUSE00000281973 PAN-1_domain (28/78 aa) CDS CDS
ENSMUSE00000281968 PAN-1_domain (47/79 aa) CDS Deleted
ENSMUSE00000281959 PAN-1_domain (33/79 aa) CDS CDS + stop codon + UTR
ENSMUSE00000211436 PAN-1_domain (49/81 aa) CDS
ENSMUSE00000211445 PAN-1_domain (33/81 aa) CDS
ENSMUSE00000211442 PAN-1_domain (47/80 aa) CDS
ENSMUSE00000211432 PAN-1_domain (34/80 aa) CDS
ENSMUSE00000211443 Peptidase_S1_S6 (44/228 aa) | Peptidase_S1A_nudel (34/118 aa) CDS
ENSMUSE00000211440 Peptidase_S1_S6 (60/228 aa) | Peptidase_S1A_nudel (60/118 aa) CDS
ENSMUSE00000211438 Peptidase_S1_S6 (33/228 aa) | Peptidase_S1A_nudel (26/118 aa) CDS
ENSMUSE00001048232 Peptidase_S1_S6 (47/228 aa) CDS
ENSMUSE00000281904 Peptidase_S1_S6 (47/228 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available