IKMC Project Report - KOMP-CSD (ID: 80090)

2210010C04Rik MGI:1914623 ENSMUSG00000029882 OTTMUSG00000026905
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Genotype confirmed

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed 2210010C04Riktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) EPD0709_4_E11 C57BL/6NTac;C57BL/6NTac;C57BL/6N-Atm1Brd/a view
( about ) 		WTSI/UCD
Southern Blot na TV Backbone Assay pass 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000031931 protein_coding No protein product (NMD) view

Predicted translation: 

MKTLIFLAFLGAAVALPLDDDDDKIVGGYTCQRNALPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSQLPFTPSVS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000478895 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000473360 Peptidase_S1_S6 (43/216 aa) CDS CDS
ENSMUSE00000403191 Peptidase_S1_S6 (86/216 aa) CDS Deleted
ENSMUSE00000193586 Peptidase_S1_S6 (46/216 aa) CDS CDS + stop codon + UTR
ENSMUSE00000193588 Peptidase_S1_S6 (43/216 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0709_4_E11 HTGRS6013_A_G07 2210010C04Riktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view yes view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a pass Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0709_4_C10 HTGRS6013_A_G07 2210010C04Riktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0709_4_E12 HTGRS6013_A_G07 2210010C04Riktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 45180 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGRS6013_A_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45180 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06013_A_8_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45180 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06013_A_7_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45180 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06013_A_6_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45180 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06013_A_2_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45180 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06013_A_1_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45180 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06013_A_4_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45180 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06013_A_5_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45180 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06013_A_3_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
45180 Knockout-First - Reporter Tagged Insertion PCS6013_A_G07