IKMC Project Report - EUCOMM (ID: 82604)

Qdpr MGI:97836 ENSMUSG00000015806 OTTMUSG00000027775
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 6 are protein-coding. Following removal of the floxed region, 6 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000015950 protein_coding No protein product (NMD) view

Predicted translation: 

MAASGEARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEASASVVVKMTDSFTEQADQRFLKTVT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000749190 DH_sc/Rdtase_SDR (22/153 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001015165 DH_sc/Rdtase_SDR (31/153 aa) CDS CDS
ENSMUSE00000185411 DH_sc/Rdtase_SDR (33/153 aa) CDS Deleted
ENSMUSE00000973370 DH_sc/Rdtase_SDR (48/153 aa) CDS CDS + stop codon + UTR
ENSMUSE00001087094 DH_sc/Rdtase_SDR (21/153 aa) CDS
ENSMUSE00000981222 CDS
ENSMUSE00000287403 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000117425 protein_coding Residual C-terminal product view

Predicted translation: 

MMWKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTL
DTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTTDGKTELTPAYF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000711498 UTR UTR
ENSMUSE00001057185 UTR + start codon + CDS
ENSMUSE00000185411 CDS Deleted
ENSMUSE00000973370 CDS UTR + start codon + CDS
ENSMUSE00001087094 CDS CDS
ENSMUSE00000981222 CDS CDS
ENSMUSE00000717851 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000118097 protein_coding Residual C-terminal product view

Predicted translation: 

MMWKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTL
DTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTTDGKTELTPAYF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000717000 UTR + start codon + CDS
ENSMUSE00000185411 CDS Deleted
ENSMUSE00000973370 CDS UTR + start codon + CDS
ENSMUSE00001087094 CDS CDS
ENSMUSE00000981222 CDS CDS
ENSMUSE00000709032 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000120867 protein_coding Residual C-terminal product view

Predicted translation: 

MMWKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTL
DTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTTDGKTELTPAYF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000717312 UTR UTR
ENSMUSE00001057185 UTR + start codon + CDS
ENSMUSE00000185411 CDS Deleted
ENSMUSE00000973370 CDS UTR + start codon + CDS
ENSMUSE00001087094 CDS CDS
ENSMUSE00000981222 CDS CDS
ENSMUSE00000718409 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000154962 protein_coding No analysis available: incomplete transcript
ENSMUST00000127562 protein_coding No analysis available: incomplete transcript
ENSMUST00000149290 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0697_8_A12 PG00213_Z_4_G01 Qdprtm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0697_8_B10 PG00213_Z_4_G01 Qdprtm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0697_8_B09 PG00213_Z_4_G01 Qdprtm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0697_8_B12 PG00213_Z_4_G01 Qdprtm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0774_1_F01 PG00213_Z_4_G01 Qdprtm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_G01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_B11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_5_H02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_B08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_C11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_D07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_A07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_5_H08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_G11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_C12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_B10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_C09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_D10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_D03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_5_C10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_5_H10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_D11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_5_B06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_F10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_H09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_5_H04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_5_A09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_A06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_B05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_E03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_5_D02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_H08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_D01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_A03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_5_H06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_5_A06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_A04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_4_D06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_5_E05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45872 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00213_Z_5_B03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
45872 Knockout-First - Reporter Tagged Insertion PCS00213_B_D01