IKMC Project Report - EUCOMM (ID: 84243)

Oxr1 MGI:2179326 ENSMUSG00000022307
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Oxr1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) EPD0600_1_B09 C57BL/6NTac;C57BL/6NTac;C57BL/6N-Atm1Brd/a view
( about ) 		WTSI/Monterotondo
Southern Blot na TV Backbone Assay pass 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR pass Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 7 are protein-coding. Following removal of the floxed region, 7 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000110297 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MSVSNLSWLKKKSQSVDITAPGFNPLGGAGKQAPQASKPPAPKTPIIEEEQNNSANTQKHPSRKSELKRFYTIDTGQKKT
LDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVS
PLSPTSSEAEFDKTTTPDVAHPKEAPPASTVSGIRPARVVSSTSEEEEAFTEKFLKINCKYITIGKGTVSGVLLVTPNNI
MFDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIELDQLSGRGSCHSKKATGVSAEDADPRARDQG
NDSASTAPRSTEESLSEDAFTESELSPIREELLSSEPRQEKSSDASSESVQTVSQMEVQSLTATSEAANVPDRTSSNPGA
LSHETGLSGLETATKGGDKATESLQEVSGPKEQSTEVKGQDNQDSSHQESSLQQEAGEDSVSSGETVELKEKPAVLKDQQ
GQELKRDSETEVEELRKLWKTHSMQQAKQQRDTIQQVSQRESKHSSAAADAHGEGSSLLKEKRRHRLHKFLCLRVGKPMR
KTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDSGEYTREPGFIVVKKMDESEANEAPAGEAA
AREWEVVSVAEYHRRIDALNTEELRTLCRRLQITTREDINSKQVAPAKADLEPESFRPNLSDPSELLLPDQIEKLTKHLP
PRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQRGICSLA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000683442 UTR UTR
ENSMUSE00001007169 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001087509 CDS CDS
ENSMUSE00001018068 Peptidoglycan-bd_lysin (1/43 aa) CDS CDS
ENSMUSE00000624062 Peptidoglycan-bd_lysin (36/43 aa) CDS CDS
ENSMUSE00000624061 Peptidoglycan-bd_lysin (6/43 aa) CDS CDS
ENSMUSE00000624060 GRAM (13/56 aa) CDS CDS
ENSMUSE00000624059 GRAM (43/56 aa) CDS CDS
ENSMUSE00001033941 CDS CDS
ENSMUSE00001046656 CDS CDS
ENSMUSE00001084550 CDS CDS
ENSMUSE00000972811 CDS CDS
ENSMUSE00001024212 CDS CDS
ENSMUSE00001069945 TLDc (35/136 aa) CDS CDS
ENSMUSE00001001613 TLDc (32/136 aa) CDS Deleted
ENSMUSE00001061009 TLDc (25/136 aa) CDS Deleted
ENSMUSE00001038234 TLDc (45/136 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000170127 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MDYLTTFTGKSGRLLRGTASRLWGLGGGGEARQVRFEDYLREPAPGDPGCGPEELRPPSPASPEGPDTGQKKTLDKKDGR
RMSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSS
EAEFDKTTTPDVAHPKEAPPASTVSGIRPARVVSSTSEEEEAFTEKFLKINCKYITIGKGTVSGVLLVTPNNIMFDPHKT
DPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIELDQLSGRGSCHSKKATGVSAEDADPRARDQGNDSASTA
PRSTEESLSEDAFTESELSPIREELLSSEPRQEKSSDASSESVQTVSQMEVQSLTATSEAANVPDRTSSNPGALSHETGL
SGLETATKGGDKATESLQEVSGPKEQSTEVKGQDNQDSSHQESSLQQEAGEDSVSSGETVELKEKPAVLKDQQGQELKRD
SETEVEELRKLWKTHSMQQAKQQRDTIQQVSQRESKHSSAAADAHGEGSSLLKEKRRHRLHKFLCLRVGKPMRKTFVSQA
SATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDSGEYTREPGFIVVKKMDESEANEAPAGEAAAREWEIT
TREDINSKQVAPAKADLEPESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTP
VLMVIKDSDGQRGICSLA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000910169 CDS CDS
ENSMUSE00001018068 Peptidoglycan-bd_lysin (1/43 aa) CDS CDS
ENSMUSE00000624062 Peptidoglycan-bd_lysin (36/43 aa) CDS CDS
ENSMUSE00000624061 Peptidoglycan-bd_lysin (6/43 aa) CDS CDS
ENSMUSE00000624060 GRAM (13/56 aa) CDS CDS
ENSMUSE00000624059 GRAM (43/56 aa) CDS CDS
ENSMUSE00001033941 CDS CDS
ENSMUSE00001046656 CDS CDS
ENSMUSE00001084550 CDS CDS
ENSMUSE00001024212 CDS CDS
ENSMUSE00001069945 TLDc (35/136 aa) CDS CDS
ENSMUSE00001001613 TLDc (32/136 aa) CDS Deleted
ENSMUSE00001061009 TLDc (25/136 aa) CDS Deleted
ENSMUSE00001038234 TLDc (45/136 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000022918 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSE
AEFDKTTTPDVAHPKEAPPASTVSGIRPARVVSSTSEEEEAFTEKFLKINCKYITIGKGTVSGVLLVTPNNIMFDPHKTD
PLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIELDQLSGRGSCHSKKATGVSAEDADPRARDQGNDSASTAP
RSTEESLSEDAFTESELSPIREELLSSEPRQEKSSDASSESVQTVSQMEVQSLTATSEAANVPDRTSSNPGALSHETGLS
GLETATKGGDKATESLQEVSGPKEQSTEVKGQDNQDSSHQESSLQQEAGEDSVSSGETVELKEKPAVLKDQQGQELKRDS
ETEVEELRKLWKTHSMQQAKQQRDTIQQVSQRESKHSSAAADAHGEGSSLLKEKRRHRLHKFLCLRVGKPMRKTFVSQAS
ATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDSGEYTREPGFIVVKKMDESEANEAPAGEAAAREWEVVS
VAEYHRRIDALNTEELRTLCRRLQITTREDINSKQVAPAKADLEPESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPW
TLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQRGICSLA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000350104 UTR UTR
ENSMUSE00001051120 Peptidoglycan-bd_lysin (1/43 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000624062 Peptidoglycan-bd_lysin (36/43 aa) CDS CDS
ENSMUSE00000624061 Peptidoglycan-bd_lysin (6/43 aa) CDS CDS
ENSMUSE00000624060 GRAM (13/56 aa) CDS CDS
ENSMUSE00000624059 GRAM (43/56 aa) CDS CDS
ENSMUSE00001033941 CDS CDS
ENSMUSE00001046656 CDS CDS
ENSMUSE00001084550 CDS CDS
ENSMUSE00000972811 CDS CDS
ENSMUSE00001024212 CDS CDS
ENSMUSE00001069945 TLDc (35/136 aa) CDS CDS
ENSMUSE00001001613 TLDc (32/136 aa) CDS Deleted
ENSMUSE00001061009 TLDc (25/136 aa) CDS Deleted
ENSMUSE00000649500 TLDc (45/136 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000090096 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSE
AEFDKTTTPDVAHPKEAPPASTVSGIRPARVVSSTSEEEEAFTEKFLKINCKYITIGKGTVSGVLLVTPNNIMFDPHKTD
PLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIELDQLSGRGSCHSKKATGVSAEDADPRARDQGNDSASTAP
RSTEESLSEDAFTESELSPIREELLSSEPRQEKSSDASSESVQTVSQMEVQSLTATSEAANVPDRTSSNPGALSHETGLS
GLETATKGGDKATESLQEVSGPKEQSTEVKGQDNQDSSHQESSLQQEAGEDSVSSGETVELKEKPAVLKDQQGQELKRDS
ETEVEELRKLWKTHSMQQAKQQRDTIQQVSQRESKHSSAAADAHGEGSSLLKEKRRHRLHKFLCLRVGKPMRKTFVSQAS
ATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDSGEYTREPGFIVVKKMDESEANEAPAGEAAAREWEITT
REDINSKQVAPAKADLEPESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPV
LMVIKDSDGQRGICSLA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000683442 UTR UTR
ENSMUSE00001052244 UTR UTR
ENSMUSE00000996053 UTR UTR
ENSMUSE00001051120 Peptidoglycan-bd_lysin (1/43 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000624062 Peptidoglycan-bd_lysin (36/43 aa) CDS CDS
ENSMUSE00000624061 Peptidoglycan-bd_lysin (6/43 aa) CDS CDS
ENSMUSE00000624060 GRAM (13/56 aa) CDS CDS
ENSMUSE00000624059 GRAM (43/56 aa) CDS CDS
ENSMUSE00001033941 CDS CDS
ENSMUSE00001046656 CDS CDS
ENSMUSE00001084550 CDS CDS
ENSMUSE00001024212 CDS CDS
ENSMUSE00001069945 TLDc (35/136 aa) CDS CDS
ENSMUSE00001001613 TLDc (32/136 aa) CDS Deleted
ENSMUSE00001061009 TLDc (25/136 aa) CDS Deleted
ENSMUSE00001038234 TLDc (45/136 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000179393 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSE
AEFDKTTTPDVAHPKEAPPASTVSGIRPARVVSSTSEEEEAFTEKFLKINCKYITIGKGTVSGVLLVTPNNIMFDPHKTD
PLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIELDQLSGRGSCHSKKATGVSAEDADPRARDQGNDSASTAP
RSTEESLSEDAFTESELSPIREELLSSEPRQEKSSDASSESVQTVSQMEVQSLTATSEAANVPDRTSSNPGALSHETGLS
GLETATKGGDKATESLQEVSGPKEQSTEVKGQDNQDSSHQESSLQQEAGEDSVSSGETVELKEKPAVLKDQQGQELKRDS
ETEVEELRKLWKTHSMQQAKQQRDTIQQVSQRESKHSSAAADAHGEGSSLLKEKRRHRLHKFLCLRVGKPMRKTFVSQAS
ATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDSGEYTREPGFIVVKKMDESEANEAPAGEAAAREWEITT
REDINSKQVAPAKADLEPESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPV
LMVIKDSDGQRGICSLA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000991231 UTR UTR
ENSMUSE00001052244 UTR UTR
ENSMUSE00000996053 UTR UTR
ENSMUSE00001051120 Peptidoglycan-bd_lysin (1/43 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000624062 Peptidoglycan-bd_lysin (36/43 aa) CDS CDS
ENSMUSE00000624061 Peptidoglycan-bd_lysin (6/43 aa) CDS CDS
ENSMUSE00000624060 GRAM (13/56 aa) CDS CDS
ENSMUSE00000624059 GRAM (43/56 aa) CDS CDS
ENSMUSE00001033941 CDS CDS
ENSMUSE00001046656 CDS CDS
ENSMUSE00001084550 CDS CDS
ENSMUSE00001024212 CDS CDS
ENSMUSE00001069945 TLDc (35/136 aa) CDS CDS
ENSMUSE00001001613 TLDc (32/136 aa) CDS Deleted
ENSMUSE00001061009 TLDc (25/136 aa) CDS Deleted
ENSMUSE00001038234 TLDc (45/136 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000090095 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSE
AEFDKTTTPDVAHPKEAPPASTVSGIRPARVVSSTSEEEEAFTEKFLKINCKYITIGKGTVSGVLLVTPNNIMFDPHKTD
PLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIELDQLSGRGSCHSKKATGVSAEDADPRARDQGNDSASTAP
RSTEESLSEDAFTESELSPIREELLSSEPRQEKSSDASSESVQTVSQMEVQSLTATSEAANVPDRTSSNPGALSHETGLS
GLETATKGGDKATESLQEVSGPKEQSTEVKGQDNQDSSHQESSLQQEAGEDSVSSGETVELKEKPAVLKDQQGQELKRDS
ETEVEELRKLWKTHSMQQAKQQRDTIQQVSQRESKHSSAAADAHGEGSSLLKEKRRHRLHKFLCLRVGKPMRKTFVSQAS
ATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDSGEYTREPGFIVVKKMDESEANEAPAGEAAAREWEITT
REDINSKQVAPAKADLEPESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPV
LMVIKDSDGQRGICSLA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001013693 UTR UTR
ENSMUSE00001051120 Peptidoglycan-bd_lysin (1/43 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000624062 Peptidoglycan-bd_lysin (36/43 aa) CDS CDS
ENSMUSE00000624061 Peptidoglycan-bd_lysin (6/43 aa) CDS CDS
ENSMUSE00000624060 GRAM (13/56 aa) CDS CDS
ENSMUSE00000624059 GRAM (43/56 aa) CDS CDS
ENSMUSE00001033941 CDS CDS
ENSMUSE00001046656 CDS CDS
ENSMUSE00001084550 CDS CDS
ENSMUSE00001024212 CDS CDS
ENSMUSE00001069945 TLDc (35/136 aa) CDS CDS
ENSMUSE00001001613 TLDc (32/136 aa) CDS Deleted
ENSMUSE00001061009 TLDc (25/136 aa) CDS Deleted
ENSMUSE00001038234 TLDc (45/136 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000166917 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MSRLWYGKKGRRHQPVNHKYTLITTREDINSKQVAPAKADLEPESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTL
VYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQRGICSLA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000901273 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001024212 CDS CDS
ENSMUSE00001069945 TLDc (35/136 aa) CDS CDS
ENSMUSE00001001613 TLDc (32/136 aa) CDS Deleted
ENSMUSE00001061009 TLDc (25/136 aa) CDS Deleted
ENSMUSE00001038234 TLDc (45/136 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0600_1_B09 MPGS8003_A_B11 Oxr1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view yes view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0600_1_G08 MPGS8003_A_B11 Oxr1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0600_1_D08 MPGS8003_A_B11 Oxr1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0600_1_F08 MPGS8003_A_B11 Oxr1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0600_1_G07 MPGS8003_A_B11 Oxr1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0600_1_A12 MPGS8003_A_B11 Oxr1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0600_1_C12 MPGS8003_A_B11 Oxr1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0600_1_E08 MPGS8003_A_B11 Oxr1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0600_1_G12 MPGS8003_A_B11 Oxr1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0600_1_H07 MPGS8003_A_B11 Oxr1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0600_1_H09 MPGS8003_A_B11 Oxr1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 257634 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) MPGS8003_A_B11 L1L2_Bact_P L3L4_pD223_DTA_spec view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
257634 Knockout First, Reporter-tagged insertion with conditional potential MPCS8001_A_C08