IKMC Project Report - KOMP-CSD (ID: 84663)

Abca16 MGI:2388711 ENSMUSG00000051900 OTTMUSG00000029808
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000120490 protein_coding No protein product (NMD) view

Predicted translation: 

MNQLTVNQLTVLLWKNFTLKKRQIISTSAELLAALLFVIMLLIFRALTDMNIAGPYHFTAQPIAIMPSFIKDAQEWELVY
IPSEIDVVREIIEDVKRNLNTTIKVRGFPSEAEFEEYILFDNMSQKVLAAIVFDCGFKNKSDPLPLQGILRKDSWQYSML
WTRASCCIMKAVLGKSCLMKSTL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000470841 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000506178 CDS CDS
ENSMUSE00000505166 CDS CDS
ENSMUSE00001085486 CDS Deleted
ENSMUSE00001072270 CDS CDS + stop codon + UTR
ENSMUSE00000477387 CDS
ENSMUSE00000481533 CDS
ENSMUSE00001043556 CDS
ENSMUSE00000992803 CDS
ENSMUSE00000971751 CDS
ENSMUSE00000493722 ABC_transporter-like (17/121 aa) CDS
ENSMUSE00000492552 ABC_transporter-like (43/121 aa) CDS
ENSMUSE00000993385 ABC_transporter-like (52/121 aa) CDS
ENSMUSE00000985222 ABC_transporter-like (9/121 aa) CDS
ENSMUSE00000495297 CDS
ENSMUSE00000500949 CDS
ENSMUSE00000499924 CDS
ENSMUSE00000366352 CDS
ENSMUSE00000262139 CDS
ENSMUSE00000262131 CDS
ENSMUSE00000204746 CDS
ENSMUSE00000475448 CDS
ENSMUSE00000511729 CDS
ENSMUSE00000262106 CDS
ENSMUSE00000204704 ABC_transporter-like (30/119 aa) CDS
ENSMUSE00000204747 ABC_transporter-like (63/119 aa) CDS
ENSMUSE00000976094 ABC_transporter-like (27/119 aa) CDS
ENSMUSE00000334598 CDS
ENSMUSE00000485972 CDS
ENSMUSE00000485024 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000056042 protein_coding No protein product (NMD) view

Predicted translation: 

MNQLTVNQLTVLLWKNFTLKKRQIISTSAELLAALLFVIMLLIFRALTDMNIAGPYHFTAQPIAIMPSFIKDAQEWELVY
IPSEIDVVREIIEDVKRNLNTTIKVRGFPSEAEFEEYILFDNMSQKVLAAIVFDCGFKNKSDPLPLQGILRKDSWQYSML
WTRASCCIMKAVLGKSCLMKSTL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000470841 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000506178 CDS CDS
ENSMUSE00000505166 CDS CDS
ENSMUSE00001085486 CDS Deleted
ENSMUSE00001072270 CDS CDS + stop codon + UTR
ENSMUSE00000477387 CDS
ENSMUSE00000481533 CDS
ENSMUSE00000486967 CDS
ENSMUSE00000984689 CDS
ENSMUSE00000485026 CDS
ENSMUSE00000971751 CDS
ENSMUSE00000493722 ABC_transporter-like (17/121 aa) CDS
ENSMUSE00000492552 ABC_transporter-like (43/121 aa) CDS
ENSMUSE00000993385 ABC_transporter-like (52/121 aa) CDS
ENSMUSE00000985222 ABC_transporter-like (9/121 aa) CDS
ENSMUSE00000495297 CDS
ENSMUSE00000500949 CDS
ENSMUSE00000499924 CDS
ENSMUSE00000366352 CDS
ENSMUSE00000262139 CDS
ENSMUSE00000262131 CDS
ENSMUSE00000204746 CDS
ENSMUSE00000475448 CDS
ENSMUSE00000511729 CDS
ENSMUSE00000262106 CDS
ENSMUSE00000204704 ABC_transporter-like (30/119 aa) CDS
ENSMUSE00000204747 ABC_transporter-like (63/119 aa) CDS
ENSMUSE00000976094 ABC_transporter-like (27/119 aa) CDS
ENSMUSE00000334598 CDS
ENSMUSE00000485972 CDS
ENSMUSE00000485024 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000144122 nonsense_mediated_decay Residual C-terminal product view

Predicted translation: 

MLYHESSAGKKLFDEIDTVIQRFPYPSHPQDKLLWISSPFIPLMFILMFSSIVLSIMRSIVFEKEKRLKEYQLIMGLRNW
IIWIGYFFTFFPLYVIIILLICILLFVQLVWLLLLETSYFLPVSFPIISSLNTMGC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000837825 UTR UTR
ENSMUSE00001049704 UTR Deleted
ENSMUSE00001034658 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000779692 CDS CDS
ENSMUSE00001067691 CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001090023 UTR UTR
ENSMUSE00001074743 UTR UTR
ENSMUSE00000821866 UTR UTR
ENSMUSE00001043718 UTR UTR
ENSMUSE00000963788 UTR UTR
ENSMUSE00000823411 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000153845 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0702_1_C12 HTGR06016_A_1_F03 Abca16tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0702_1_A11 HTGR06016_A_1_F03 Abca16tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 47855 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06016_A_8_F03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 47855 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06016_A_6_F03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 47855 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06016_A_6_H04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 47855 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06016_A_8_E04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 47855 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06016_A_7_F03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 47855 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06016_A_2_F03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 47855 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06016_A_3_F03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 47855 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGRS06016_A_F03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 47855 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06016_A_1_F03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
47855 Knockout-First - Reporter Tagged Insertion PCS06016_A_F03