IKMC Project Report - EUCOMM (ID: 89812)
Kcng1 MGI:3616086 ENSMUSG00000074575 OTTMUSG00000016048
Mice no data available
Mutagenesis Predictions
This gene has 3 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000109191 | protein_coding | Residual N-terminal, unknown C-terminal | view | |||||||||||||||||||||||
|
Predicted translation: MTLLPGDNSHYDYSALSCASDTSFHPAFFPQRQAIKGVFYRRAQRLRPQDDLHQSCSLGDRRRQIIINVGGIKYSLPWTT LDEFPLTRLGQLKACTNFDDILSVCDDYDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDH LDGCCKRRYLQKIEEFAEMMEREEEEEPLDSEDQESEGPSASEGRLSRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT AVNLSVSTLPSLREEEEQ
|
||||||||||||||||||||||||||
| ENSMUST00000099069 | protein_coding | Residual N-terminal, unknown C-terminal | view | |||||||||||||||||||||||
|
Predicted translation: MTLLPGDNSHYDYSALSCASDTSFHPAFFPQRQAIKGVFYRRAQRLRPQDDLHQSCSLGDRRRQIIINVGGIKYSLPWTT LDEFPLTRLGQLKACTNFDDILSVCDDYDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDH LDGCCKRRYLQKIEEFAEMMEREEEEEPLDSEDQESEGPSASEGRLSRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT AVNLSVSTLPSLREEEEQ
|
||||||||||||||||||||||||||
| ENSMUST00000131749 | protein_coding | Target region does not overlap transcript | ||||||||||||||||||||||||
ES Cell Clones With Conditional Potential
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | EPD0718_3_E03 | HTGRS6007_A_G07 | Kcng1tm1a(EUCOMM)Wtsi | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0718_3_B04 | HTGRS6007_A_G07 | Kcng1tm1a(EUCOMM)Wtsi | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0718_3_E04 | HTGRS6007_A_G07 | Kcng1tm1a(EUCOMM)Wtsi | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0718_3_H03 | HTGRS6007_A_G07 | Kcng1tm1a(EUCOMM)Wtsi | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0718_3_H04 | HTGRS6007_A_G07 | Kcng1tm1a(EUCOMM)Wtsi | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones Without Conditional Potential
Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | EPD0718_3_B03 | HTGRS6007_A_G07 | Kcng1tm1e(EUCOMM)Wtsi | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0718_3_B02 | HTGRS6007_A_G07 | Kcng1tm1e(EUCOMM)Wtsi | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0718_3_D02 | HTGRS6007_A_G07 | Kcng1tm1e(EUCOMM)Wtsi | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0718_3_G04 | HTGRS6007_A_G07 | Kcng1tm1e(EUCOMM)Wtsi | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0718_3_D01 | HTGRS6007_A_G07 | Kcng1tm1e(EUCOMM)Wtsi | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0718_3_G03 | HTGRS6007_A_G07 | Kcng1tm1e(EUCOMM)Wtsi | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0718_3_F02 | HTGRS6007_A_G07 | Kcng1tm1e(EUCOMM)Wtsi | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0718_3_H02 | HTGRS6007_A_G07 | Kcng1tm1e(EUCOMM)Wtsi | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 106351 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | HTGRS6007_A_G07 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 106351 | Knockout-First - Reporter Tagged Insertion | PCS6007_A_G07 |