IKMC Project Report - EUCOMM (ID: 89886)

Wdr36 MGI:1917819 ENSMUSG00000038299
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000053663 protein_coding No protein product (NMD) view

Predicted translation:

MAEMESAVEGRTASVLFAGFRALGLFSNEVPHVVRYSALKRRFYVTTCVGKSFHTYDVQKLSLVAVSNSVPQDICCMAAD
GRLVFAAYGNVFSAFARNKEIVHTFKGHKAEIHLLQPFGDHVISVDTDSVLIIWHIYSEEEYLQLTFDKSVFKISTILHP
STYLNKVLLGSEQGSLQLWNIKSNKLLYTFPGWKVGVTALQQVKMGLYSHFLQFMKNSTRAWVMD*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000376245 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000384583 CDS CDS
ENSMUSE00000352057 CDS CDS
ENSMUSE00000413147 CDS CDS
ENSMUSE00000369936 CDS CDS
ENSMUSE00000411141 CDS CDS
ENSMUSE00000368945 CDS Deleted
ENSMUSE00000376928 WD40_repeat (28/31 aa) CDS Deleted
ENSMUSE00000398151 WD40_repeat (3/31 aa) | WD40_repeat (23/29 aa) CDS Deleted
ENSMUSE00000355439 WD40_repeat (7/29 aa) CDS CDS
ENSMUSE00000396048 CDS CDS + stop codon + UTR
ENSMUSE00000364894 CDS
ENSMUSE00000385163 WD40_repeat (1/32 aa) CDS
ENSMUSE00000341934 WD40_repeat (32/32 aa) CDS
ENSMUSE00000350449 WD40_repeat (15/38 aa) CDS
ENSMUSE00000229535 WD40_repeat (23/38 aa) CDS
ENSMUSE00000229521 CDS
ENSMUSE00000229507 CDS
ENSMUSE00000229490 SSU_processome_Utp21 (46/223 aa) CDS
ENSMUSE00000229478 SSU_processome_Utp21 (40/223 aa) CDS
ENSMUSE00000229458 SSU_processome_Utp21 (28/223 aa) CDS
ENSMUSE00000229441 SSU_processome_Utp21 (63/223 aa) CDS
ENSMUSE00000879517 SSU_processome_Utp21 (47/223 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000166214 protein_coding No protein product (NMD) view

Predicted translation:

MAEMESAVEGRTASVLFAGFRALGLFSNEVPHVVRYSALKRRFYVTTCVGKSFHTYDVQKLSLVAVSNSVPQDICCMAAD
GRLVFAAYGNVFSAFARNKEIVHTFKGHKAEIHLLQPFGDHVISVDTDSVLIIWHIYSEEEYLQLTFDKSVFKISTILHP
STYLNKVLLGSEQGSLQLWNIKSNKLLYTFPGWKVGVTALQQVKMGLYSHFLQFMKNSTRAWVMD*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000376245 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000384583 CDS CDS
ENSMUSE00000352057 CDS CDS
ENSMUSE00000413147 CDS CDS
ENSMUSE00000369936 CDS CDS
ENSMUSE00000411141 CDS CDS
ENSMUSE00000368945 CDS Deleted
ENSMUSE00000376928 WD40_repeat (28/31 aa) CDS Deleted
ENSMUSE00000398151 WD40_repeat (3/31 aa) | WD40_repeat (23/29 aa) CDS Deleted
ENSMUSE00000355439 WD40_repeat (7/29 aa) CDS CDS
ENSMUSE00000396048 CDS CDS + stop codon + UTR
ENSMUSE00000364894 CDS
ENSMUSE00000385163 WD40_repeat (1/32 aa) CDS
ENSMUSE00000341934 WD40_repeat (32/32 aa) CDS
ENSMUSE00000350449 WD40_repeat (15/38 aa) CDS
ENSMUSE00000229535 WD40_repeat (23/38 aa) CDS
ENSMUSE00000229521 CDS
ENSMUSE00000229507 CDS
ENSMUSE00000229490 SSU_processome_Utp21 (46/208 aa) CDS
ENSMUSE00000229478 SSU_processome_Utp21 (40/208 aa) CDS
ENSMUSE00000229458 SSU_processome_Utp21 (28/208 aa) CDS
ENSMUSE00000229441 SSU_processome_Utp21 (63/208 aa) CDS
ENSMUSE00000659768 SSU_processome_Utp21 (22/208 aa) CDS
ENSMUSE00000892837 SSU_processome_Utp21 (10/208 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Conditional Potential

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0795_2_D09 HTGR06004_A_1_C10 Wdr36tm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 94578 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06004_A_1_C10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
94578 Knockout-First - Reporter Tagged Insertion PCS6004_A_C10