IKMC Project Report - KOMP-CSD (ID: 93694)

L3mbtl4 MGI:2444889 ENSMUSG00000041565 OTTMUSG00000028472
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000093007 protein_coding Residual C-terminal product view

Predicted translation:

MHESSVTTAETWSWEQYLREGNAVAAPVELFSKDQSFPEHENGFQVGMRLEGIDARRPSVFCVLSVAEVCGYRLRLHFDG
YLSCYDFWTNAGSPDIHPVGWCQKTKHELHIPRDYRKDKFVWMDYLKACRLQNAPKKLFRNRSSNGPVPREFQVGMKLEA
VDRRNPCLMCVATIADIVEDRVRVHFDSLDDSFDYWCDVNSPYIQPVGWCQENGRTLVAPQGYPHPDKFSWTDYLRASQS
KAVPAKAFGMRTPHGFLPNMKLEAVDKRNPQLIRVATIADVDDYRVKIHFDGWDHKYDYWVDADSQDIHPIGWCDVTGHP
LEVPYGSKHVKILPGQPACPTPGCRGIGHIRGPRYAGHHSAFGCPYSDVNLKREAALQDRLREQTQANLELDPSHSKSEN
PCNLNVNGKCENANSQCRLVQQAKCLKIKGKEDIDLDNLFRAMVTHSCRGEYSAAQVQQMLHQPLSMTSTSAHPFRDIPL
SREQHCKLLPGVADIQASQVARWTVDEVAEFVQSLLGCEEHAKCFKKEQIDGKAFLLLTQADIVKVMRIKLGPALKIYNS
ILMFRNSQDVTEDASSQEDKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000657031 UTR UTR
ENSMUSE00000657030 UTR UTR
ENSMUSE00001016904 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001021451 CDS Deleted
ENSMUSE00000979972 CDS CDS
ENSMUSE00001013783 Mbt (20/73 aa) CDS CDS
ENSMUSE00000769617 Mbt (46/73 aa) CDS CDS
ENSMUSE00000752992 Mbt (8/73 aa) CDS CDS
ENSMUSE00000776045 Mbt (40/71 aa) CDS CDS
ENSMUSE00000836724 Mbt (27/71 aa) CDS CDS
ENSMUSE00000727683 Mbt (6/71 aa) CDS CDS
ENSMUSE00000981647 Mbt (27/69 aa) CDS CDS
ENSMUSE00000974161 Mbt (39/69 aa) CDS CDS
ENSMUSE00000752573 Mbt (4/69 aa) | Znf_C2HC (22/30 aa) CDS CDS
ENSMUSE00000759797 Znf_C2HC (9/30 aa) CDS CDS
ENSMUSE00001078945 CDS CDS
ENSMUSE00000892441 CDS CDS
ENSMUSE00000505311 SAM_type1 (5/64 aa) | SAM_2 (5/61 aa) CDS CDS
ENSMUSE00000499130 SAM_type1 (21/64 aa) | SAM_2 (21/61 aa) CDS CDS
ENSMUSE00000606392 SAM_type1 (38/64 aa) | SAM_2 (35/61 aa) CDS CDS
Legend: in frame deleted frameshifted
ENSMUST00000124543 protein_coding No analysis available: incomplete transcript
ENSMUST00000139383 nonsense_mediated_decay Residual C-terminal product view

Predicted translation:

MHESSVTTAETWSWEQYLREGNAVAAPVELFSKDQSFPEHENGFQVGMRLEGIDARRPSVFCVLSVAEVCGYRLRLHFDG
YLSCYDFWTNAGSPDIHPVGWCQKTKHELHIPRDYRKDKFVWMDYLKACRLQNAPKKLFRNRSSNGPVPREFQVGMKLEA
VDRRNPCLMCVATIADIVEDRVRVHFDSLDDSFDYWCDVNSPYIQPVGWCQENGRTLVAPQEDSTWFFAKHEVGSCGQKE
PPVDSCCYHCRC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000657031 UTR UTR
ENSMUSE00000657030 UTR UTR
ENSMUSE00001016904 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001021451 CDS Deleted
ENSMUSE00000979972 CDS CDS
ENSMUSE00001013783 Mbt (20/73 aa) CDS CDS
ENSMUSE00000769617 Mbt (46/73 aa) CDS CDS
ENSMUSE00000752992 Mbt (8/73 aa) CDS CDS
ENSMUSE00000776045 Mbt (40/67 aa) CDS CDS
ENSMUSE00000836724 Mbt (27/67 aa) CDS CDS
ENSMUSE00001035125 Mbt (2/67 aa) CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001066998 UTR UTR
ENSMUSE00000832761 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000150573 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available