IKMC Project Report - EUCOMM (ID: 93988)

Uaca MGI:1919815 ENSMUSG00000034485
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000050183 protein_coding No protein product (NMD) view

Predicted translation: 

MKSLKSRLWKQDAPGPTSPSSPTAVASTQSAEWNKYDDRLMKAAERGDVEKVSSILAKKGVHPGKLDVEGRSAEECASPG
S*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000886437 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001028795 CDS CDS
ENSMUSE00000224468 CDS Deleted
ENSMUSE00000224446 CDS CDS + stop codon + UTR
ENSMUSE00000224427 Ankyrin_rpt (8/31 aa) CDS
ENSMUSE00000224403 Ankyrin_rpt (24/31 aa) CDS
ENSMUSE00000224379 Ankyrin_rpt (33/33 aa) CDS
ENSMUSE00000435436 CDS
ENSMUSE00000224335 CDS
ENSMUSE00000224316 CDS
ENSMUSE00000224298 CDS
ENSMUSE00000224278 CDS
ENSMUSE00000224262 CDS
ENSMUSE00000224245 CDS
ENSMUSE00000224228 CDS
ENSMUSE00000396859 CDS
ENSMUSE00000435441 CDS
ENSMUSE00000435439 CDS
ENSMUSE00000533258 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0767_1_E10 PG00248_Z_2_F04 Uacatm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0767_1_H10 PG00248_Z_2_F04 Uacatm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0767_1_A10 PG00248_Z_2_F04 Uacatm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0767_1_D11 PG00248_Z_2_F04 Uacatm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0767_1_E11 PG00248_Z_2_F04 Uacatm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0767_1_A09 PG00248_Z_2_F04 Uacatm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0767_1_D12 PG00248_Z_2_F04 Uacatm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0767_1_E09 PG00248_Z_2_F04 Uacatm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0767_1_D09 PG00248_Z_2_F04 Uacatm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 378551 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00248_Z_2_F04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 378551 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00248_Z_2_E05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 378551 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00248_Z_2_A10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 378551 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00248_Z_2_H12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 378551 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00248_Z_2_C11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 378551 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00248_Z_2_G05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 378551 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00248_Z_2_H11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 378551 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00248_Z_2_C05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 378551 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00248_Z_2_H03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 378551 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00248_Z_2_F09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 378551 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00248_Z_2_H09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
378551 Knockout-First - Reporter Tagged Insertion PCS00248_A_B07